KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2345Help
Entry
SYNGTS_2345       CDS       T02098                                 

Gene name
rcp1
Definition
(GenBank) CheY subfamily protein Rcp1/Rcp/Rre27
  KO
K11355  two-component system, chemotaxis family, response regulator Rcp1
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy02020  Two-component system
Module
syy_M00510  Cph1-Rcp1 (light response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:syy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SYNGTS_2345 (rcp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:syy02022]
    SYNGTS_2345 (rcp1)
Two-component system [BR:syy02022]
 CheA family
  Cph1-Rcp1 [MD:M00510]
   SYNGTS_2345 (rcp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: BAK51093
Structure
PDB: 

Position
2608890..2609333
Genome map
AA seq 147 aa AA seqDB search
MSDESNPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSP
RPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTK
SRNLKDLFKMVQGIESFWLETVTLPAA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaatctaatccccccaaggtcattttgctggtggaagatagcaaagccgac
agccgccttgtccaggaggtgttgaaaaccagcaccatcgaccacgaactgatcattctc
cgggatggtttggcggccatggcctttttacagcaacagggagaatacgaaaattcccct
cgccccaacctaattttgctggatttaaatcttcctaaaaaggatggccgggaagtgttg
gcggaaatcaaacaaaacccggacctaaaaagaattcccgtggtagtgttaaccacttcc
cacaatgaggatgatgtgattgccagttacgaactccacgttaattgttatttaaccaaa
tcccgcaatttgaaggatttattcaagatggtgcaagggattgaatccttttggctagaa
acagtcactttaccggcagcttaa

DBGET integrated database retrieval system