KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2649Help
Entry
SYNGTS_2649       CDS       T02098                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00010  Glycolysis / Gluconeogenesis
syy00052  Galactose metabolism
syy00500  Starch and sucrose metabolism
syy00520  Amino sugar and nucleotide sugar metabolism
syy00521  Streptomycin biosynthesis
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01120  Microbial metabolism in diverse environments
syy01130  Biosynthesis of antibiotics
syy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNGTS_2649 (glk)
   00052 Galactose metabolism
    SYNGTS_2649 (glk)
   00500 Starch and sucrose metabolism
    SYNGTS_2649 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SYNGTS_2649 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNGTS_2649 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SYNGTS_2649 (glk)
Enzymes [BR:syy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYNGTS_2649 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAK51397
Position
complement(2943887..2944954)
Genome map
AA seq 355 aa AA seqDB search
MGAMGVNFLAGDIGGTKTILALVTINESSPGLARPVTLFEQTYSSPAFPDLVPMVQQFRQ
EAAFVLGNPISVAKACFAIAGPVIDNTCRLTNLDWHLSGDRLAQELAIAQVDLINDFAAV
GYGILGLGSEDLTVLQAAPVDPSGAIAILGAGTGLGQCYVIPQGQGRYRVFASEGAHGDF
APRSPLEWQLLEYLKKKYSLGRISIERVVSGMGIAMIYEFLRHQYPERESAQFSKLYQTW
NREKDQETKTVDLAAAVSQAALEGTDVLADQAMELFLGAYGAEAGNLALKLLPRGGLYVA
GGIAPKIIPLLEKGSFMQGFSDKGRMQSLMGTIPVQVVLNAKVGLIGAAVCAAQS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggggccatgggcgtaaattttttggcaggggatatcggcggcactaaaacgattctg
gccctggtgacgataaacgagagtagcccagggttggcccggccggtgactctgtttgaa
cagacctacagcagtccagcttttcccgatctggtgcccatggtgcaacaattccgtcaa
gaagcagcctttgtgttgggtaacccaatctccgttgctaaggcctgtttcgccattgcc
ggccctgtgatcgataacacctgtcgcctcactaatttagattggcatctcagcggcgat
cgcctggcccaggaattggccattgcccaggttgacctcatcaatgattttgccgctgtg
ggttacggcattttagggctagggtcagaggatttaaccgtactccaggccgctcccgtg
gatccgtcaggggcgatcgccatattgggagcaggcaccggcttgggacaatgctacgta
attccccagggccaaggaagatatcgagtttttgcctccgaaggagcccacggtgacttt
gccccccgatcgcctttggaatggcagttattggagtatctcaaaaagaagtattcccta
gggcggatttccattgaacgggtggtatccggcatgggcatcgccatgatttacgaattt
ttgcggcaccaatacccagaacgggaatcagcccaattcagcaaactctaccaaacctgg
aatcgagaaaaggaccaagaaaccaaaaccgtcgatctggccgccgccgtatcccaagcc
gccctggaaggcacagatgtattggctgaccaagccatggaactttttctcggggcctat
ggagcagaggcaggaaatcttgctttgaagctactacccagaggtggtttgtacgttgcc
ggtggtattgcccccaaaattatccctttactggaaaagggcagttttatgcaaggcttt
agcgacaaaggcaggatgcaaagcttaatggggacaattcccgtacaggtggtactcaac
gccaaagttggcctaattggcgcggcggtttgtgcggcccagtcttag

DBGET integrated database retrieval system