KEGG   Synechocystis sp. PCC 6803: MYO_111640Help
Entry
MYO_111640        CDS       T02468                                 

Gene name
gdh
Definition
(GenBank) glucose dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
syz00030  Pentose phosphate pathway
syz01100  Metabolic pathways
syz01120  Microbial metabolism in diverse environments
syz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MYO_111640 (gdh)
Enzymes [BR:syz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     MYO_111640 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_7 THF_DHG_CYH_C
Motif
Other DBs
NCBI-GeneID: 14616586
NCBI-ProteinID: AGF51418
Position
complement(1274706..1275452)
Genome map
AA seq 248 aa AA seqDB search
MELTGKTALVTGGGIRVGRALVMALAEAGCNVFIHYGNSQTGALEVQQEVEALGRKAFTY
SADLSDAQATQGIIPKAQEVFGQVDILINSASVFPLEDKFFQVDLDLWEWIFAVNLRAPF
QLSQAFAQQVAGDRQGKIININDARIPRPRPDHFVYRLTKRGLWDMTEILALELAPNITV
NGLALGQILEAPEAPDPEEFMRDYAERRIPLKMTGNPKVVTDAALYLLQQDFLSGTTIRL
DGAEYLKF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaattaactggaaaaacagccctggtcaccgggggaggcataagggttggtcgggcc
ctagttatggccctggcggaagccggttgtaacgtctttattcactacggtaattcccag
accggagccctagaggttcagcaagaagtggaagcattgggtaggaaagcttttacctac
tccgccgatttgagcgatgcccaggccacccaaggaattattcccaaagcccaggaagtc
tttggccaggtggatattctgatcaacagtgcctcggtttttcccctagaagataaattc
tttcaagtggatctcgacctgtgggaatggatttttgccgttaatctccgggcccccttt
cagttgtcccaggcctttgctcaacaagtagccggcgatcgccaaggaaaaattattaac
attaacgatgcccgcattccccgaccaaggccagaccattttgtttaccgtcttaccaaa
cggggtttgtgggatatgacggaaattttagccctggaattggcccccaatatcaccgtt
aatggcctcgccctaggacagattttagaagctccggaagcgccggacccggaagagttt
atgcgggattatgcagagcgacgtattcctttaaaaatgaccggcaatcccaaagtagtc
actgatgcggccctatatttgctacaacaggattttctgagtggcaccaccattcgttta
gatggagcagaatatttgaagttttag

DBGET integrated database retrieval system