KEGG   Synechocystis sp. PCC 6803: MYO_113800Help
Entry
MYO_113800        CDS       T02468                                 

Gene name
dfp
Definition
(GenBank) pantothenate metabolism flavoprotein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
syz00770  Pantothenate and CoA biosynthesis
syz01100  Metabolic pathways
Module
syz_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:syz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MYO_113800 (dfp)
Enzymes [BR:syz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     MYO_113800 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     MYO_113800 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-GeneID: 14616802
NCBI-ProteinID: AGF51632
Position
complement(1512599..1513807)
Genome map
AA seq 402 aa AA seqDB search
MVKGKRILIGVGGGIAAYKICEVVSQLFQQGAEVRVILTAEAEKFVTPLTFTTLARHPAY
GDADFWQPIHHRPLHIDLGEWADIFLIAPLTAHTLAKLGHGFADDLLSNTVLASSCPILL
APAMNTDMWEQEAVQRNLQQLLGDRRYHLLAPNGGLLACDRRGVGRLAEPAQIMHRLQAL
LFTGGQEDLRGKRILITAGGTQEYLDAVRFIGNPSTGKMGLALAQSAGDRGARVTLIHGP
IGDLPIPMGVISMAVVNAEQMEQALAQQAPLADWIVMAAAVADVKPAQTWTGKIAKQDLP
DSLPLAPVPDLIAQVSKQKRPHQLLVGFAAQAGDIVTPAKEKLQRKNLDVIVANPIDQPQ
SGFGTDSNQAVIIDRHGSQTAIAPCSKLAMAHRIWQYLLERI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaggggaaacgcatcctaatcggggtgggtggcggcattgcggcctataaaatc
tgtgaggtggtgtcccaactattccagcaaggggcggaggtgcgggtaatcctcactgcc
gaagccgaaaaatttgttactcccttgacctttaccaccctggctcgccatcccgcttac
ggcgacgcagatttttggcagcccatacatcaccgtcccctccatattgacctgggggaa
tgggcggatattttcctgattgctcccctcacggcccacactttggcgaaactaggccat
ggttttgccgatgatctactcagcaatacggtgttagcctccagttgtccgatcctttta
gcccccgccatgaatacggatatgtgggagcaggaagcggtgcaaaggaatttacaacaa
ttgctgggcgatcgccgttatcatctgttagcccccaatgggggactgttggcctgtgac
cggcggggagtggggcgtttggcggaaccggcgcaaattatgcatcgactgcaagcactg
ctgttcaccggaggtcaggaagatttacggggtaaaaggattcttatcaccgctgggggc
acccaggaatatctcgatgcagtgcggtttattggtaatccgtccaccggaaaaatgggt
ttagctctggcccagtcggccggcgatcggggggcaagggtgactctcatccatggcccc
ataggggatttgcccatacccatgggagtaatcagtatggcggtggtcaacgccgagcaa
atggagcaagccttggcccaacaagctcccttggcggattggattgtgatggccgccgct
gtggccgatgttaaaccggctcaaacatggacaggcaaaatagctaaacaggatttaccc
gacagtttgccgttggctccggtaccggatttaattgcccaggtgagcaaacaaaaacgg
ccccatcaattgctagtaggttttgctgcccaagcgggagatattgttaccccagccaaa
gaaaagttgcagaggaaaaatctagatgtaattgttgccaatcccattgatcagccccaa
tcaggctttggcaccgacagtaatcaagcggtaattattgaccgccacggttcccaaacg
gcgatcgccccttgttcaaagctggccatggcccaccgcatttggcaatatctgttggaa
cggatttga

DBGET integrated database retrieval system