KEGG   Siansivirga zeaxanthinifaciens: AW14_00225Help
Entry
AW14_00225        CDS       T03699                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sze  Siansivirga zeaxanthinifaciens
Pathway
sze00900  Terpenoid backbone biosynthesis
sze01110  Biosynthesis of secondary metabolites
sze01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sze00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AW14_00225
Enzymes [BR:sze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     AW14_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AJR02303
UniProt: A0A0C5W5A2
Position
47567..48889
Genome map
AA seq 440 aa AA seqDB search
MSKSIAGFSKLSKSKKIDWIVETYFSNTEDAKSVLKQYWNSNEKLQQLHDEFIENTITNY
YLPLGVAPNFLINNKIYTIPMAIEESSVVAAASKAAKFWMDRGGFKTTVISTTKIGQVHF
MYHGNPETLKNYFNYIKPQLISDAKPITKNMEKRGGGILDIELRDKTNAIEGYYQLHASF
ETLDAMGANFINSCLEQFAKTFKNEALTFDAFTDEDKNIQIIMSILSNYVPECLVRAEVS
CKVEDLSDDASIPSEEFANKFVQAVKIAEIEPYRAVTHNKGIMNGIDAVVLATGNDFRAI
EACVHAYASKNGSYSSLSHAKIENGIFTFWMEIPLALGTVGGLTGLHPLVKLSLELLHHP
SAKELMEIVAVAGLAQNFAALRSLTTTGIQQGHMKMHLMNILNQFEATTTEKETLIEYFK
NHIVSHSAVVDAIKNLRSKN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatctattgctggcttttccaaactatcaaaatctaaaaagattgattggatt
gttgaaacttatttttcaaataccgaagatgccaaatctgttttaaaacaatactggaat
tctaacgaaaaattacaacagttacacgacgagtttattgaaaacaccataaccaactac
tacttgccgcttggtgtagcgcccaactttttaataaacaacaagatttacaccatacca
atggctatcgaggaaagctctgtggtcgccgcagccagcaaggccgccaaattctggatg
gatcgtggcggatttaaaaccaccgttatttctaccactaaaattggtcaggtacatttt
atgtatcatggtaacccagaaaccttaaaaaactattttaattatataaaaccgcaatta
attagcgatgctaaacccataactaaaaatatggaaaagcgtggcggtggtattttagat
attgaattgcgcgataaaaccaatgctattgaagggtattaccaactacatgcatcgttt
gaaaccctcgatgctatgggcgccaattttataaactcttgtttagagcagtttgcaaaa
acatttaaaaatgaagctttaacttttgatgcttttacagatgaagacaagaacattcaa
ataataatgagtattctttctaactatgttccagaatgtttagttagagctgaagtaagt
tgtaaggttgaagacctaagtgatgatgcttctattccttcagaagaatttgctaataaa
tttgttcaggctgttaaaattgcagaaatagaaccttatcgggccgttacgcataacaag
ggaattatgaatggtattgatgctgtagttttagcaacaggaaacgattttagagctatt
gaagcctgtgtacacgcctatgcatcaaaaaacggtagttatagcagcttgtcgcatgca
aaaattgaaaacggcatatttacgttttggatggaaattccgttggctttaggtactgtt
ggtggtttaactggtttacaccccttagtaaaattatctttagagcttttacaccaccca
agcgcaaaagaacttatggaaattgttgctgttgccggacttgctcaaaattttgcagct
ttacgctcgctaacaacaactggcatacaacaaggacacatgaaaatgcacctgatgaat
attttaaatcagtttgaagcaactaccaccgaaaaagaaacgcttatcgagtattttaaa
aaccatattgtttcgcatagcgctgtggttgatgctattaagaacttaagaagtaaaaat
taa

DBGET integrated database retrieval system