KEGG   Siansivirga zeaxanthinifaciens: AW14_01370Help
Entry
AW14_01370        CDS       T03699                                 

Definition
(GenBank) N5-carboxyaminoimidazole ribonucleotide mutase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
sze  Siansivirga zeaxanthinifaciens
Pathway
sze00230  Purine metabolism
sze01100  Metabolic pathways
sze01110  Biosynthesis of secondary metabolites
sze01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sze00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AW14_01370
Enzymes [BR:sze01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     AW14_01370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC
Motif
Other DBs
NCBI-ProteinID: AJR02494
UniProt: A0A0C5WAU5
Position
278133..278615
Genome map
AA seq 160 aa AA seqDB search
MQKVGVIMGSKSDLPVMQDAIDILKEFDIEVEVDIVSAHRTPEKLFDYGKNAHLRGISVI
IAGAGGAAHLPGMVASLSPLPVIGVPVKSSNSIDGWDSVLSILQMPGGVPVATVALNGAK
NAGILAAQIIGSNDLNVLAKIVAFKESLKEKVYESAKDLK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtaggcgtaataatgggtagtaaaagtgacttgccagtaatgcaagacgca
atagatattttaaaagagtttgatattgaagttgaagtagatattgtttcggctcaccgt
actccagagaaattatttgattatggcaaaaatgcacacttaagaggcatctctgtaata
attgctggtgctggtggcgctgcgcatttaccgggcatggtagcttctttatcgccacta
cctgtaattggtgttcctgtaaaaagtagtaattctattgatggctgggactcggtactt
tctattctgcaaatgcctggaggtgttccggttgctacagtggcattaaacggcgctaaa
aacgcggggattttagccgctcaaataataggatctaacgatttaaatgtgttagctaaa
attgttgcttttaaagaaagtttaaaagagaaagtttacgaatcggcaaaagacttaaaa
taa

DBGET integrated database retrieval system