KEGG   Siansivirga zeaxanthinifaciens: AW14_06165Help
Entry
AW14_06165        CDS       T03699                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
sze  Siansivirga zeaxanthinifaciens
Pathway
sze00670  One carbon pool by folate
sze01100  Metabolic pathways
sze01120  Microbial metabolism in diverse environments
sze01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sze00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AW14_06165
Enzymes [BR:sze01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     AW14_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AJR03297
UniProt: A0A0C5WAH5
Position
1360715..1361671
Genome map
AA seq 318 aa AA seqDB search
MKVTDHIKKANGKTLFSFEVIPPQKGKNIQDLYNNIDPLMEFNPPFIDVTTSREEYVYID
KGNGLLDKRITRMRPGTVGICASIMHKYKVDAIPHLLCGGFTKEETEYVLVDCHYLGIDN
VMALRGDSRKDEPYFIPTKDGNAFASELVAQISDLNKGKYLHDNVEIEHKYDFCVGVAGY
PEKHMEAPSLQNDLKRLKAKVDAGADYVVTQMFFDNKKYFDFVEKAKEMGITVPIIPGIK
PIAVKRHLQILPQVFKIDLPEDLIDAVEACKDNNAVRQVGIEFAIQQSRELKEAGVPFLH
YYSMGKSDNIKAIASQLF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaacagatcacataaagaaagctaacggaaaaacattgttttcgtttgaagtt
ataccgccgcaaaaggggaaaaatattcaggatttatacaataatatcgacccgttaatg
gagtttaatccgccttttatagatgtaacgacttcgagagaggagtatgtttatatcgat
aaaggtaacggccttttagataagcgtattactcgtatgcgcccgggaacagttggtatt
tgtgcttcgattatgcataagtataaggtggatgcgataccgcatttattgtgtggtggt
tttacaaaagaggaaaccgaatatgtgttggttgattgtcattatttagggattgataat
gttatggccttgcgcggtgattcgagaaaggatgagccttattttattccaacaaaggat
ggtaacgcttttgcaagtgaattggttgcgcagatttcagatttaaacaaagggaaatat
ttacatgataatgtagaaattgaacacaagtacgatttttgtgtgggtgttgctggttat
cctgagaaacacatggaagcgccatcgctacaaaacgacctgaaacgtttaaaggctaag
gtagatgcgggtgccgattatgtggtgacccaaatgttttttgataataaaaagtatttt
gattttgttgaaaaggctaaagaaatgggaattactgtgccaattattcccggaattaag
cctatagccgttaaacgacacctacaaattttacctcaggtttttaaaattgatttacct
gaagatttaattgatgcggttgaggcttgtaaagataataatgcggttagacaggtgggt
attgagtttgccatacaacaatcgagagagttaaaagaagcgggtgtgccatttttacat
tattattctatgggtaaaagtgataatattaaagccatagcttcgcagctcttttaa

DBGET integrated database retrieval system