KEGG   Siansivirga zeaxanthinifaciens: AW14_09885Help
Entry
AW14_09885        CDS       T03699                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sze  Siansivirga zeaxanthinifaciens
Pathway
sze00480  Glutathione metabolism
sze00590  Arachidonic acid metabolism
sze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AW14_09885
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AW14_09885
Enzymes [BR:sze01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AW14_09885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SF3A3
Motif
Other DBs
NCBI-ProteinID: AJR03887
UniProt: A0A0C5WC64
Position
complement(2129166..2129684)
Genome map
AA seq 172 aa AA seqDB search
MFLSCLFKTNAQTAPTASIYDIKINSLDGSPINLSDYKGKHILFVNVASKCGFTGQYVDL
QKLYETYQDKLMIIGAPCNQFGGQEPGTVKEIQNFCQANYGVTFVMTEKLDVKGTNQHPL
YQWLTKQSINGKTDSSVKWNFQKYLVDGNGHLVDYYFSATKPLSDSITKHLK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtttctatcttgcttatttaaaacgaatgcacaaacggctccaacagcgtctatttat
gacataaaaataaatagtctagatggttcgcctataaatttatctgattacaaggggaaa
cacatcctctttgtaaatgtagcttcaaaatgtggctttactggacaatatgtagactta
caaaaactatatgaaacctatcaagataaacttatgattattggagcaccttgcaatcag
tttggtggacaagagccgggaaccgtaaaggaaattcaaaatttttgtcaggcaaattat
ggagtaaccttcgtaatgaccgaaaaactagatgttaaaggcactaaccagcaccctctg
tatcaatggcttaccaaacaatctattaacggaaaaacagattcttccgtaaagtggaat
tttcaaaaatatttagtagacggtaatgggcatttagtagattattatttttcggctacg
aagcctttaagtgatagtattaccaaacatttaaaataa

DBGET integrated database retrieval system