KEGG   Candidatus Nitrosocosmicus oleophilus: NMY3_00751Help
Entry
NMY3_00751        CDS       T04185                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
taa  Candidatus Nitrosocosmicus oleophilus
Pathway
taa00900  Terpenoid backbone biosynthesis
taa01110  Biosynthesis of secondary metabolites
taa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:taa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMY3_00751 (mvaA)
Enzymes [BR:taa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     NMY3_00751 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ALI34960
UniProt: A0A0N7HBF2
Position
complement(682798..684078)
Genome map
AA seq 426 aa AA seqDB search
MSKNLDKKKFRNMTHEERLQFIKVNTSLDDNEIDLFRNTSVFKFSNIDGMIENAIGIFPL
PIGIANNFVINNKEYLVPMAIEEPSVIAAASNAAKIASKGGGFMAQADDSIMIGQIQLIP
NSSYDQPKVQNLIELISNNKIDIISLANTKSKFAKCLDIKIKQVNDESINKLGQMIIIEI
MVDTKDAMGANVVNTMCEAIAPEIEALTGCKVVLKILSNYATQRLVKCRGIFPTELIGGE
EILKRILFAYSLAFTDVHRAVTHNKGIMNGIDSVAIATGQDFRAIEAGCHAYACRDGQYR
SLTKWYQNSKGDLVGEIEIPMAVGIIGGITNTHPIVKACLKLMNISNSQELATIIAASGL
AQNFSAIRALSNEGIQKGHMKLHSKNIAIIAGATNDKIEMVSRKMVEERNVSVSRAKEIL
ESLKEN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatttggataagaaaaaatttaggaacatgacacatgaagaaagacttcaa
tttattaaagtaaatacaagcttagatgataacgaaattgatttgtttagaaatacatcg
gtatttaaatttagtaatatcgatgggatgatagaaaatgctatcggaatttttccactc
cctatcggaatagcaaacaattttgtcatcaacaataaggaatatttggttccgatggca
atagaagaaccatctgtgatagctgctgcaagcaacgccgcaaagatagcaagtaaaggt
ggaggttttatggctcaagcagatgattctatcatgattgggcaaattcaattaatccca
aatagctcatacgatcaaccaaaagttcaaaatctaatcgagttgatatcaaataataag
attgacataatatctctagcaaatactaaaagcaaatttgcgaaatgtttagacattaaa
attaaacaagtcaatgatgaaagcataaacaaactcggacagatgataataatagaaatc
atggtggataccaaagatgcaatgggtgcaaatgttgttaatacaatgtgtgaagccatt
gcacccgaaatagaagcattaacaggatgtaaagtagtactaaaaattttatctaattat
gccacccaacgcctagtaaaatgtagagggatatttccgacagaattaattggtggtgaa
gaaattcttaaaaggattttatttgcttattcgctagcgttcactgatgtccatagagcc
gttactcataataaaggaattatgaatgggattgatagcgtagcaatagccactggtcag
gattttagagctattgaggcaggatgtcatgcatatgcgtgcagagatggacagtataga
tctttgactaaatggtatcaaaattctaaaggagatctcgtgggagaaatagaaattcca
atggcggtgggaataattggagggataacaaacacacaccctatcgttaaagcgtgtttg
aaattaatgaatatatcaaattcgcaggaattagctaccattattgctgcttcaggatta
gcacagaatttctcagcaattagagctttatctaacgaaggtattcagaagggacacatg
aaactgcactcaaaaaatattgcaataatcgcaggagctacaaatgacaaaatagaaatg
gtctctagaaaaatggttgaagagagaaatgtatcagtttcaagagccaaggaaattcta
gaatcattaaaagaaaattaa

DBGET integrated database retrieval system