KEGG   Candidatus Nitrosocosmicus oleophilus: NMY3_00881Help
Entry
NMY3_00881        CDS       T04185                                 

Gene name
pcaF
Definition
(GenBank) Beta-ketoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
taa  Candidatus Nitrosocosmicus oleophilus
Pathway
taa00071  Fatty acid degradation
taa00072  Synthesis and degradation of ketone bodies
taa00280  Valine, leucine and isoleucine degradation
taa00310  Lysine degradation
taa00362  Benzoate degradation
taa00620  Pyruvate metabolism
taa00630  Glyoxylate and dicarboxylate metabolism
taa00640  Propanoate metabolism
taa00650  Butanoate metabolism
taa00720  Carbon fixation pathways in prokaryotes
taa00900  Terpenoid backbone biosynthesis
taa01100  Metabolic pathways
taa01110  Biosynthesis of secondary metabolites
taa01120  Microbial metabolism in diverse environments
taa01130  Biosynthesis of antibiotics
taa01200  Carbon metabolism
taa01212  Fatty acid metabolism
taa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:taa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMY3_00881 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    NMY3_00881 (pcaF)
   00640 Propanoate metabolism
    NMY3_00881 (pcaF)
   00650 Butanoate metabolism
    NMY3_00881 (pcaF)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NMY3_00881 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NMY3_00881 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    NMY3_00881 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NMY3_00881 (pcaF)
   00310 Lysine degradation
    NMY3_00881 (pcaF)
   00380 Tryptophan metabolism
    NMY3_00881 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMY3_00881 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NMY3_00881 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NMY3_00881 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:taa04147]
    NMY3_00881 (pcaF)
Enzymes [BR:taa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NMY3_00881 (pcaF)
Exosome [BR:taa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMY3_00881 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: ALI35090
UniProt: A0A0N9Y1D9
Position
810513..811832
Genome map
AA seq 439 aa AA seqDB search
MHAIKYVTKKCLYEGVSVYYIYTVQLKTKAESIILRFYALTLHFYYAKAILRYMGEKVYV
LGAGSTKYGKLHESIIEIALNASRDAIESAGITPRDVKAGYISNVFGVADKQVHMAPVIM
SNLGIPDVPGLTIESACGSGSVMFREAFANVSAGFYDCVLALGVEKVTHTSTVESTTLFS
YCSDFFYEGGNGASFPGLFGSMARAYLATYKATEEDLARVAVKNHENGFLNPKAHVRKKI
TIDDVLKSPVVASPLKLYDCCPFSDGASAVILCNEEFAKKSGNPYMEVVGSGRGASPASV
QSRKDITTIPSTVEAALQAYKMANLSPKDIDFVEVHDCFTIAELIDIEDLGFYPKGSAAQ
AVREGRTRLNSDITVNPSGGLKSKGHPIGATGVGQVVEVFEQFTNKAGERTVKDAEIAMT
HNFGATGASAAVHIFKKIK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgcaattaaatatgttaccaaaaaatgtctctatgagggcgtttccgtttattac
atatatactgttcaattaaaaacaaaagcagaatcaataatattgagattttatgcactc
actttacatttttattatgctaaagccattctaagatatatgggtgaaaaggtctatgta
cttggtgctggcagtacaaagtatggcaaattacatgagagtattattgagatagccttg
aatgcttcaagagatgccattgaatcagctggtataactccaagagacgtgaaagctgga
tacatttcgaacgtctttggtgtggctgataaacaggttcacatggctccggtaattatg
agtaaccttgggatccctgatgtacctggacttaccattgaatctgcatgtggttctggc
tctgttatgtttagagaagcttttgcaaatgtatctgctggattttatgattgtgtttta
gcactgggagttgaaaaagtaactcataccagtactgttgaaagcacaacactcttttcc
tattgttctgattttttttatgaggggggtaacggagcatcgtttcccggtctttttggt
tcgatggctagagcctatctggctacttataaagcgacagaggaagatctggcccgagtg
gctgttaaaaatcatgaaaatggatttcttaatccaaaagcccatgtaaggaagaaaatt
actatagatgatgtgttaaaatctcctgtggttgcctctccactaaagttatatgattgc
tgccctttctctgacggtgcctcagctgtgatattatgtaatgaggaattcgcaaaaaaa
agcggaaatccatatatggaagtagtgggctcaggcaggggtgcatcacctgcttcagtc
caatctagaaaagatataaccactattccaagtaccgttgaagcggcccttcaagcttat
aaaatggcaaatctatctccaaaagatattgattttgttgaagtgcacgattgttttacc
atagccgaattaatagatatcgaagatttaggattctatccaaagggttctgctgctcag
gctgttagagaggggcggaccagattaaatagcgatattactgttaacccttcaggcggt
ttgaaatctaaaggccatccaataggagccaccggtgttggtcaagttgtagaagtattt
gagcaatttacaaataaagctggagagcgaacggttaaagatgctgagatagccatgact
cataattttggagctaccggggctagcgcagcagtacatatattcaagaaaataaaatag

DBGET integrated database retrieval system