KEGG   Candidatus Nitrosocosmicus oleophilus: NMY3_03308Help
Entry
NMY3_03308        CDS       T04185                                 

Gene name
pckA
Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
taa  Candidatus Nitrosocosmicus oleophilus
Pathway
taa00010  Glycolysis / Gluconeogenesis
taa00020  Citrate cycle (TCA cycle)
taa00620  Pyruvate metabolism
taa01100  Metabolic pathways
taa01110  Biosynthesis of secondary metabolites
taa01120  Microbial metabolism in diverse environments
taa01130  Biosynthesis of antibiotics
taa01200  Carbon metabolism
Module
taa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:taa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMY3_03308 (pckA)
   00020 Citrate cycle (TCA cycle)
    NMY3_03308 (pckA)
   00620 Pyruvate metabolism
    NMY3_03308 (pckA)
Enzymes [BR:taa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     NMY3_03308 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ALI37492
UniProt: A0A0N9Y5F2
Position
complement(3043872..3045434)
Genome map
AA seq 520 aa AA seqDB search
MDFTINEGQRNLTVPLLVESAILNDEGKLSFTGSLSVKTGKFTGRSPEDKYIVKDEITAK
SVDWGKVNHPISEENFEKIFTRMTKYIHDNNLAQKLYTFDGFVGADISSRLSIRVITDRA
WHSLFATQIFINASQEELSHFKPDFTLLSINDFASFPELEGTKSETFIIISFKRNLVLMG
STSYAGEIKKSMFSVMNFLLPKKGIFPMHCSANLGKDDRSALFFGLSGTGKTTLSADENR
RLVGDDEHGWSDNGVFNFEGGCYAKCINLNKDKEPQIWNAIKFGSVMENVVIDPFTREPD
FTDGSLTENTRVVYPLNFIPGAVIPSVCGHPSVIIFLTADAFGVLPPISKLSKEGAMYHF
MSGYTSKLAGTERGITEPKETFSQCFGAPFMPLRAAEYAKLLGEKITKYNSKVYLINTGW
SGGPYGIGKRIDLKYTRQMVSATLKGALDEVPYETHETFNLDYPTSCYDIPASILNPRNT
WHDKNQYDFSAKRLAKLFINNFRKFEPTSAEIIKAGPHLN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggactttacaattaatgaggggcaaagaaatttaacagttcccctattagttgaatca
gctattctgaatgatgagggtaagctatcatttaccggttcgttatcggtaaagaccgga
aaatttactggtcgttcgcctgaggataaatatattgtcaaggatgaaattactgccaag
tcggtagattggggtaaagttaaccatccaatttctgaagaaaactttgaaaaaatattt
actcgtatgacaaagtatatccatgataataatttagcccagaaactctatacttttgat
ggatttgttggagctgacatctcttccaggctatctataagagttattacagatagagca
tggcatagtctattcgcaactcaaattttcataaacgcatcacaagaagaattgtcacat
ttcaaacctgattttactttgttgtcaatcaatgattttgcatctttcccagagttagaa
ggaacaaaatctgaaactttcattattattagtttcaagcgaaatttggtcctgatgggg
tcaacatcttatgctggtgaaataaagaaatccatgttttcagtcatgaattttctttta
cccaaaaaaggtatatttcctatgcattgttcggcaaatttgggcaaggatgataggtcg
gccctattttttggtttgtcaggaactggaaaaacaaccctttcggccgatgaaaatcga
cgattagtgggagacgatgaacatggctggtctgataatggtgtatttaattttgaaggg
ggttgttatgctaagtgtattaatctaaacaaggacaaagaaccacagatttggaatgcc
attaagtttggttcggtaatggagaatgttgttattgatccttttacaagggaacctgat
tttacagatggtagtttaacagaaaatactcgtgttgtctatcctttgaattttatacct
ggagccgttattccaagtgtctgcggtcatccatccgtgattatttttcttactgcagat
gcctttggggtccttcctcctatatctaaattatcaaaggagggtgccatgtatcacttt
atgtcgggatatactagtaaattagcagggactgagcgaggaatcactgaaccaaaagag
acgttttctcaatgttttggagcccctttcatgccattaagagctgcagaatatgcgaag
ttactaggagagaagataaccaaatataattcaaaagtttatttgatcaataccggctgg
tcgggcggtccttatggaataggtaaacgaatagatctaaaatataccaggcagatggta
tctgcaacgctcaaaggcgcactagatgaagttccatatgagacacacgaaacgtttaat
ctcgattaccccacgtcatgctatgacattcctgcttccatattaaatcctcgaaatact
tggcatgacaagaatcaatatgacttttctgccaaaagattggctaaattgtttataaat
aatttcaggaaatttgaacccacttctgcagaaattattaaggcgggtccgcatttgaac
tag

DBGET integrated database retrieval system