KEGG   Tumebacillus algifaecis: CIG75_07190Help
Entry
CIG75_07190       CDS       T04994                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tab  Tumebacillus algifaecis
Pathway
tab00071  Fatty acid degradation
tab00072  Synthesis and degradation of ketone bodies
tab00280  Valine, leucine and isoleucine degradation
tab00310  Lysine degradation
tab00362  Benzoate degradation
tab00380  Tryptophan metabolism
tab00620  Pyruvate metabolism
tab00630  Glyoxylate and dicarboxylate metabolism
tab00640  Propanoate metabolism
tab00650  Butanoate metabolism
tab00900  Terpenoid backbone biosynthesis
tab01100  Metabolic pathways
tab01110  Biosynthesis of secondary metabolites
tab01120  Microbial metabolism in diverse environments
tab01130  Biosynthesis of antibiotics
tab01200  Carbon metabolism
tab01212  Fatty acid metabolism
tab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CIG75_07190
   00630 Glyoxylate and dicarboxylate metabolism
    CIG75_07190
   00640 Propanoate metabolism
    CIG75_07190
   00650 Butanoate metabolism
    CIG75_07190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CIG75_07190
   00072 Synthesis and degradation of ketone bodies
    CIG75_07190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CIG75_07190
   00310 Lysine degradation
    CIG75_07190
   00380 Tryptophan metabolism
    CIG75_07190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CIG75_07190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CIG75_07190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CIG75_07190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tab04147]
    CIG75_07190
Enzymes [BR:tab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CIG75_07190
Exosome [BR:tab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CIG75_07190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASS74782
UniProt: A0A223CZL5
Position
1647288..1648469
Genome map
AA seq 393 aa AA seqDB search
MKNVYLVSAVRSAITSFGGSFKEMLPSDLASQVLSRAVERAGIEKSQVEEVILGHCIQRT
DEPNTARTAALKAGFPNTVPGYTIQRQCGSGMQAILSGMQQIQTGYADIVLAGGVEVMSS
SPHVLKQNRWGQRLQHSTLFDTVWEVLTDPLTGDMMGHTAENLAEKYNISREEQDLLALE
SHQKALAALEAGRFEKEVVPITVQAGRGKTIEVTRDEHPRADISADKLAKLRPSFQADGG
TVTAGNSSGLNDGACAVVLMSEEKVHELGVTPLAKIVAGAVAGVEPELMGYGPVPAVQKL
LGQTSLTAADIDLWEINEAFAAQYIAVEKLLDLDRSKVNVNGSGISLGHPVGATGARIVT
TLAHELHHRGLTRGIATLCIGGGMGLALMIERT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtctatcttgtctcggcagtccgttccgcgatcacatcgtttggcggctcg
ttcaaggaaatgttgccgtccgacctggcttcccaagtgctgagccgagcggttgagcgt
gcaggcatcgaaaagtcgcaggtcgaggaagtcatcctcggccactgcatccagcgcacc
gacgagccgaacaccgcccgcaccgccgcattgaaagcgggcttccccaatacggtgccg
ggctacacgatccagcgccagtgcggttctggcatgcaggcgatcctgtctgggatgcaa
cagattcaaacaggttacgccgacatcgtcctcgcgggtggtgtcgaggtgatgtcctca
tcgccgcatgtgctcaagcaaaacagatggggccagcgtctccagcacagcacccttttt
gacacagtctgggaagtgctgaccgacccgctcactggcgacatgatggggcacacggcg
gagaacctcgctgaaaaatacaatatctcccgcgaagagcaggacctgctcgcgctcgaa
tcacaccaaaaggcgctcgccgctctcgaagcgggtcgctttgaaaaagaggtcgtgccg
attaccgtgcaagctgggcgcggcaagacgatcgaagtcacccgcgacgaacacccgcgt
gctgacatatcggcagacaaactggccaaactgcgcccttcctttcaagcggatggtgga
acggtcaccgcaggcaactcatcgggcctcaacgacggggcttgtgcggtcgtcctgatg
tccgaagagaaagtgcatgagcttggcgtcacaccgcttgcgaaaatcgtcgccggtgca
gtcgcaggtgttgaaccagagttgatgggctatggcccggtgcctgcggtgcaaaagttg
ctcggacagacgagtctcaccgccgcggacatcgatctctgggagatcaacgaagcgttc
gccgcccaatatatcgccgtcgaaaaactgctcgatctcgatcgttcgaaggtgaacgtc
aacggttcgggcatctcgctcggtcatcctgtcggggcaacgggcgcgcgcatcgttacg
actcttgctcacgaactgcaccaccgcggtctcacccgcggcattgccaccttgtgcatt
ggcgggggcatgggcctcgcgctcatgatcgaacgcacgtaa

DBGET integrated database retrieval system