KEGG   Tumebacillus algifaecis: CIG75_09665Help
Entry
CIG75_09665       CDS       T04994                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
tab  Tumebacillus algifaecis
Pathway
tab00230  Purine metabolism
tab00240  Pyrimidine metabolism
tab01100  Metabolic pathways
tab01110  Biosynthesis of secondary metabolites
tab01130  Biosynthesis of antibiotics
Module
tab_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
tab_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:tab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CIG75_09665
   00240 Pyrimidine metabolism
    CIG75_09665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tab04131]
    CIG75_09665
Enzymes [BR:tab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CIG75_09665
Membrane trafficking [BR:tab04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CIG75_09665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ASS75222
UniProt: A0A223D0T2
Position
2134974..2135420
Genome map
AA seq 148 aa AA seqDB search
MAVEQTFLMVKPDGVQRGLIGEIVSRFEQKGFKLINAKLIQVPRELAESHYAELSDKPFF
GELVDFITSSPVFGMIWEGENVITTARAMMGATNPSAAAPGTIRNDFAISVGMNIIHGSD
SPENAKREIDLWFGGETLSYDKAINKWI
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgaacaaactttcctcatggtaaaaccggacggcgtacaacgcggtctgatc
ggtgaaatcgtttcccgcttcgaacagaaaggcttcaagctcatcaacgcgaaactgatc
caagttccgcgcgaactggctgaatctcactatgctgagctgtccgacaagccgttcttc
ggcgaactggttgattttatcacttcctccccggtattcggtatgatctgggaaggtgag
aacgtgatcaccaccgctcgtgcgatgatgggtgctaccaacccgtctgcagctgcaccg
ggcacgatccgcaatgattttgcaatctccgtcggcatgaacatcatccacggctccgat
tccccggagaacgcaaaacgcgaaatcgacctgtggttcggcggcgaaactttgtcctac
gacaaagcgatcaacaaatggatctaa

DBGET integrated database retrieval system