KEGG   Tumebacillus algifaecis: CIG75_09960Help
Entry
CIG75_09960       CDS       T04994                                 

Definition
(GenBank) class II aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tab  Tumebacillus algifaecis
Pathway
tab00051  Fructose and mannose metabolism
tab01100  Metabolic pathways
tab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CIG75_09960
Enzymes [BR:tab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CIG75_09960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ASS75278
UniProt: A0A223D0V7
Position
2250478..2251158
Genome map
AA seq 226 aa AA seqDB search
MSQHTLEQYRELVDRTKGEVLRASLNMYRSGLVAAVWGNVSARVPGTDLVVITPSGVDYE
MLVEEMLCVIDLNTEEVVEGSYKPSSERLLHLTVYRAREDVFGVMHTHSNYASAFSVAHK
DIPPVVEDLAQVVGGPVTCSKYALPGTPDLGRNVVKALGKKGAVLLANHGVVGVGHTVDE
AFRTCLIVEKGAQIHAVAKLIGNPVLLSLEDVEHLRHEYRHSYGQK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcacacattggaacagtatcgcgaactcgtagatcgtacgaaaggcgaagtc
ctccgcgcttcgctgaacatgtaccgctcaggtctggtcgctgcggtttggggcaacgtc
tccgcacgcgtgccgggcaccgatctggtggtgatcacaccaagcggtgtggattacgag
atgttggtcgaagagatgctctgcgtgatcgatctaaatacagaagaagtggtggagggg
agctacaagccctcatcggagcggctgttgcatctgaccgtctaccgcgcgcgcgaagac
gtatttggcgtcatgcatacgcacagcaactatgcgagtgcgttttcggtcgcacacaaa
gacatcccaccggtggtcgaagatctggcccaagtggttggcgggcctgtgacctgctcg
aagtacgcactgcctggcaccccggatctggggagaaatgtcgtcaaggcgcttggcaag
aaaggcgccgtgttgctggcaaatcacggggtcgtgggagtcgggcacacggtcgatgaa
gcgttccgcacctgtttgatcgtggaaaaaggcgcacagattcatgctgtcgcgaagctg
atcggcaatccggtcttgttgtcgctcgaggatgtcgagcatctgcggcatgagtaccga
cacagctacggacaaaaataa

DBGET integrated database retrieval system