KEGG   Tumebacillus algifaecis: CIG75_14955Help
Entry
CIG75_14955       CDS       T04994                                 

Definition
(GenBank) TIGR01457 family HAD-type hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
tab  Tumebacillus algifaecis
Pathway
tab00627  Aminobenzoate degradation
tab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tab00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CIG75_14955
Enzymes [BR:tab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     CIG75_14955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: ASS77236
UniProt: A0A223D755
Position
complement(3434435..3435211)
Genome map
AA seq 258 aa AA seqDB search
MKETEAFLIDLDGTLYRGTEVIPDAPAFICWLEQTGRKYLYVTNNSSRRPEQVAEHLRSF
GIPAEPEHVFTTSMVAAQYIKDHGGAGQKAYVIGEEGLQDALTAVGCVLSDENPDYVVQG
IDRQFTYDKLKTASLCIQAGATFLATNVDKALPTEIGLLPGAGSILVAVKTASGTEPIVM
GKPEARMIDYAIELLGVSKERAVVVGDNLETDILAGVNAGVRTALVLSGFSKKEHLAAAV
GQPTLIVDSLTDLMKAAE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagagacagaggcgtttctgatcgatttggacgggacgctgtatcggggcacagaa
gtgatcccagatgcgcccgcatttatttgctggctggagcagaccgggcgcaaatactta
tacgtcaccaacaattcctcgcgtcgtccagaacaggtcgccgagcatttgcgttccttc
ggcatcccagcggagccggagcacgttttcacgaccagcatggtggccgcacaatatatc
aaagatcatggaggcgctggtcaaaaggcatatgtgatcggcgaagagggcttgcaggat
gcgcttaccgctgtcggctgcgtgctgagtgatgaaaatcccgactatgtggtgcaggga
atcgatcgccagtttacgtacgacaagttaaaaaccgcttcgctttgcatccaagcaggc
gccaccttcctcgcgaccaacgtggataaagccctgccgaccgaaatcggtctgttgcca
ggcgctgggtcgattttggtggcggtgaaaacggcttcgggcaccgagccgatcgtcatg
ggcaagccggaagcgcgaatgatcgactacgcaatcgaactgctcggtgtttcgaaagaa
cgtgcggtcgtcgtgggcgacaatttagaaacggatatcctcgcgggtgtcaatgctggt
gtgcgcacggcgctcgtcttatccggtttttcaaaaaaagaacatctcgcagctgcagtt
ggacagccgacattgatcgtcgattcattgaccgatttgatgaaggcggcagagtaa

DBGET integrated database retrieval system