KEGG   Thermoplasma acidophilum: Ta0014Help
Entry
Ta0014            CDS       T00037                                 

Definition
(GenBank) hypothetical protein
  KO
K03653  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
tac  Thermoplasma acidophilum
Brite
Enzymes [BR:tac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Ta0014
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Ta0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAC11163
UniProt: Q9HM55
Position
12660..13337
Genome map
AA seq 225 aa AA seqDB search
MFSTGSTGQRRHTKLSNPEFFMDSLISIPFLNDESVRSTIYRKVEEFRSIGKSSKEVLFK
ELVFCILAANTSASMSLRMQESIGDGFLYLSRDDLRKALKENKYRFYNVRSDFIVKSRNI
IDDLPALVASPDHEGSRDYLVENVYGIGYKEASHFLRNVGIFDFAILDKHIMKWMAQYYP
VKKNTSRKNYLYNEEIFRNISAGFGIEPGILDLFIWYEETGTVIK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
ttgttctcgacaggctcaacagggcaaagaaggcatacgaagctttcaaatcctgaattt
tttatggattcactcatatccataccttttttaaatgatgaaagcgtaagatcaactatt
tacaggaaggttgaagaatttagatccattggaaaatcctcaaaggaagttctgttcaag
gaactggtattttgcatcctggctgccaatacctccgcatccatgagcctgaggatgcag
gaaagcataggtgacggtttcctctacctgtcaagagatgatctgcggaaggcactcaag
gaaaacaagtacaggttctacaacgtaagatctgactttatagtaaaatccaggaacatc
atagatgaccttccagcactcgtggcatcaccggaccacgagggttctagggattatctg
gttgaaaatgtttacggcataggatacaaggaagcctcacatttcctgaggaacgttgga
atattcgattttgccatactggacaagcacattatgaaatggatggcccagtactacccc
gtcaagaagaatacaagcagaaagaactatctttacaatgaggagatattcaggaatata
tcggcaggctttggaatagagccaggtatactggacctgttcatatggtatgaggaaaca
ggtacagttatcaaatag

DBGET integrated database retrieval system