KEGG   Thermoplasma acidophilum: Ta0858Help
Entry
Ta0858            CDS       T00037                                 

Definition
(GenBank) glycerate dehydrogenase related protein
  KO
K00018  glycerate dehydrogenase [EC:1.1.1.29]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00260  Glycine, serine and threonine metabolism
tac00630  Glyoxylate and dicarboxylate metabolism
tac00680  Methane metabolism
tac01100  Metabolic pathways
tac01110  Biosynthesis of secondary metabolites
tac01120  Microbial metabolism in diverse environments
tac01130  Biosynthesis of antibiotics
tac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ta0858
  09102 Energy metabolism
   00680 Methane metabolism
    Ta0858
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ta0858
Enzymes [BR:tac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     Ta0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: CAC11987
UniProt: Q9HJV5
Structure
PDB: 

Position
923205..924116
Genome map
AA seq 303 aa AA seqDB search
MDVYVNFPADGHVREIAKTVLDGFDLHWYPDYYDAEAQVIKDRYVLGKRTKMIQAISAGV
DHIDVNGIPENVVLCSNAGAYSISVAEHAFALLLAHAKNILENNELMKAGIFRQSPTTLL
YGKALGILGYGGIGRRVAHLAKAFGMRVIAYTRSSVDQNVDVISESPADLFRQSDFVLIA
IPLTDKTRGMVNSRLLANARKNLTIVNVARADVVSKPDMIGFLKERSDVWYLSDVWWNEP
EITETNLRNAILSPHVAGGMSGEIMDIAIQLAFENVRNFFEGHPRNVVRKEEYRVRSERF
LGI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttacgttaactttcccgcagacggtcatgtcagggaaattgcaaagacagtg
cttgatggtttcgatctgcactggtaccctgactattacgatgcggaggcccaggttata
aaggacagatatgtcttgggcaagaggacaaaaatgatacaggcaataagtgccggcgtg
gatcatatcgatgtaaatggaattcctgaaaacgttgttttatgcagcaatgcgggcgca
tattcgatctccgttgctgagcatgcatttgcacttctgctggctcacgcaaagaatatc
ctcgaaaacaatgaactgatgaaggcaggtatcttccggcaatcgccaacaacgcttctt
tatggcaaagccttgggaattcttggatatggcggcataggcaggagggttgcccatctg
gcaaaggcgtttggaatgagggttatcgcgtacacgcgatcctcagtagaccagaatgta
gatgttataagcgagagccctgccgatctgttcaggcaatcagacttcgtattaatagcc
ataccattgacagataaaactaggggaatggtcaatagtcgacttcttgctaatgccagg
aagaacctcaccatagtgaatgttgcacgtgcggacgtcgtttcaaagccagatatgata
ggcttccttaaggaacgatcagatgtgtggtacctttcggatgtctggtggaatgagcca
gagataactgagacaaacctcagaaatgcgatactcagcccccacgttgctggtggaatg
tccggtgaaataatggacattgcgatccagcttgcgttcgaaaacgtgagaaacttcttt
gagggccatccaaggaatgttgtaagaaaggaagaatacagggtaaggagcgaaagattc
ctggggatatag

DBGET integrated database retrieval system