KEGG   Thermoplasma acidophilum: Ta0994Help
Entry
Ta0994            CDS       T00037                                 

Definition
(GenBank) gamma-glutamyltransferase related protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00430  Taurine and hypotaurine metabolism
tac00460  Cyanoamino acid metabolism
tac00480  Glutathione metabolism
tac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Ta0994
   00460 Cyanoamino acid metabolism
    Ta0994
   00480 Glutathione metabolism
    Ta0994
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tac01002]
    Ta0994
Enzymes [BR:tac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Ta0994
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Ta0994
Peptidases and inhibitors [BR:tac01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Ta0994
CD molecules [BR:tac04090]
 Proteins
  Ta0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CAC12123
UniProt: Q9HJH4
Structure
PDB: 

Position
1064598..1066148
Genome map
AA seq 516 aa AA seqDB search
MFRSRPNALSQRSVIASSSELASLAGRDILKRGGNIFDAALAVSAMLCVTQNNLCGLGGD
LFALIRDENGQIMDLNGSGQASRAVSIDYYESMGLTKIPERGPYAAITVPGIAGSWDEIF
RKFATMDIADILEPAIRTASAGFPITQNYSDSIARSAPVIGQYRGWSSIFMPNGSVPVAG
EILKQPDLAESFRLMSEEGFRSFYDGSLADIIIAGLEGTGSPLSDRDLRVYRPLIGKPVF
TDLDEFRIYETSPNSQGITVIEWIRGMESHGYDSRTMWEAKIEDIFETMEEAYDKRRKIT
DPSYMNIAQHDSANGKKDGLPKRDHNDIGDTTYFSISDSEGRSVSIIQSNYMGFGSGIVP
KGTGFVLQNRGSYFTLQRDHPNALMPGKRTFHTLAACMVEKEHDLYASLGSMGGDIQPQV
QMQILMEILKDNTDPQAILDKPRWTEPYTIYEAPGAVYVESEELYRNVSKQISGRKVVLR
DVSQEFGTAQITTLIRGDVVVGAADPRGDGIAIPYS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggagtagacctaatgcactttcacagagatctgtaattgcttcgtcaagtgag
ctcgcgtcccttgctggacgtgatattcttaaacgcggaggaaacattttcgatgcggcg
ttagcggtcagcgccatgctgtgcgtgacgcagaataatctttgcggcctaggtggagat
ctattcgcattgatcagggatgaaaatggccagataatggatctgaatgggagcggtcaa
gcttcacgggctgtgagcatagactactacgaatcgatggggttaactaagataccggag
agggggccatacgctgccataaccgtccccgggatcgccggatcctgggacgaaatattc
aggaaattcgcgaccatggacatcgctgatatactggaacctgctatcagaacggcaagc
gctggttttccaattacgcaaaactattcggattccattgctagaagtgcgcctgtgatt
gggcagtatcgaggatggtcatcgatcttcatgcccaatggaagtgtaccagtcgcaggc
gagatattgaagcaacccgatcttgcggaatcatttcggctgatgtcagaggagggcttc
agatcattctatgatggtagccttgcagacattataatcgcaggacttgaaggaaccgga
tctccactcagcgatcgtgatcttcgcgtatacaggcctctgattgggaaacctgtattc
acagatcttgatgaattccgcatctatgaaacatcgcctaacagccaaggcatcacagtc
atcgaatggatccgtggaatggaaagccacggttatgactctaggaccatgtgggaagcg
aagatcgaggatatcttcgaaacaatggaagaagcttatgacaaaaggagaaaaattaca
gatccatcgtacatgaacatagcgcaacatgattcggctaacggcaaaaaagatgggctg
ccaaagagggatcataacgatatcggtgacacaacttacttctctataagtgattcagag
ggacgttccgtgagcataatccagagcaattatatgggattcggatccggcatagtgcca
aagggaacgggctttgtcctccagaaccgaggctcctatttcacactgcagagggatcat
ccaaacgctctgatgcccggaaagcggacgttccacacgcttgctgcgtgcatggttgag
aaagaacatgatctctacgcttcgcttggatcgatgggcggcgatatacaaccgcaggtt
cagatgcagatcttgatggaaatactgaaggacaataccgatccacaggccatactagac
aagcccagatggactgaaccatacaccatatacgaagcaccgggcgcggtgtacgtggaa
tctgaggaactgtaccgtaacgtatcgaagcaaatttctggaagaaaggtagtcctgcgc
gatgtgtctcaggaatttggaaccgcacagatcacaactctgatccgtggcgatgtggtt
gttggcgctgctgatccacggggagacggcatagctataccttactcctga

DBGET integrated database retrieval system