KEGG   Thermoplasma acidophilum: Ta1428Help
Entry
Ta1428            CDS       T00037                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00010  Glycolysis / Gluconeogenesis
tac00030  Pentose phosphate pathway
tac00051  Fructose and mannose metabolism
tac00680  Methane metabolism
tac01100  Metabolic pathways
tac01110  Biosynthesis of secondary metabolites
tac01120  Microbial metabolism in diverse environments
tac01130  Biosynthesis of antibiotics
tac01200  Carbon metabolism
tac01230  Biosynthesis of amino acids
Module
tac_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ta1428
   00030 Pentose phosphate pathway
    Ta1428
   00051 Fructose and mannose metabolism
    Ta1428
  Energy metabolism
   00680 Methane metabolism
    Ta1428
Enzymes [BR:tac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Ta1428
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Ta1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: CAC12548
UniProt: Q9HIB3
Position
complement(1476074..1477201)
Genome map
AA seq 375 aa AA seqDB search
MKVTISHIKADIGSLPGHSIVDEKVMARIQEYIEDHGKNLISDFRMAHVGDDAQITMVHT
KGIDSSEIHELAWNAFKAGTEVAKKLGLYGAGQDLLKDSFSGNLKGMGPGVAEMEINERP
SEPFIVYMMDKTEPGAFNLPIYKMFADPFNTPGLVIDEAMHSGFRFEVWDVIEHKAIFLD
APEYLYDLLALIGSKERYVIKRVYTKKENKKLPEENVAVISTDKLSLIAGKYVGKDDPAA
VVRIQSGLPAAGESLEAFAFPYLVSGWMRGSFNGPLMPVGMKDAKMTRFDGPPRVVALGY
VLKSGKLEGPVDMFDDPAFDYARRVAGEMTDHLRRMGPFEPHRLPDQEMEYTTLPVVMEK
LKDRFVDIEKETLAK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgacgatatcccatataaaggcagacataggcagtttgccgggccactccata
gtggacgaaaaggtaatggcgaggatacaggagtatatagaggatcacggaaagaacctc
atatcagatttcaggatggctcatgtgggcgatgatgcccagataaccatggtccatacc
aagggaatagatagttctgaaatccatgaactcgcgtggaacgcgttcaaggccggtact
gaagttgcgaagaagctcggattatacggagctgggcaggacctcctgaaggattcattt
tcaggaaaccttaagggaatggggccgggcgttgcggagatggagataaatgagaggccg
tcagagccattcatagtatacatgatggataagacagaacccggagcgtttaacctcccc
atctacaagatgtttgccgatccgttcaacaccccgggcctggttatagatgaggccatg
cacagcgggttccgcttcgaggtctgggacgtcatagaacacaaggccatcttccttgat
gctcctgaatacctctacgatcttctggccctcataggatcgaaggagcggtacgtgata
aagcgcgtatacacaaagaaggagaacaagaagcttcctgaggagaacgttgcggtcatc
tccacggacaagctgtcgcttatagctggaaaatacgttggcaaggatgatccggcagcg
gtggtaaggatacagtccggtcttccggccgctggagaatcgcttgaggcctttgctttc
ccgtatctagtcagcggctggatgaggggatcgttcaatggcccgctgatgcccgtaggc
atgaaggatgccaagatgacgaggtttgacgggccacccagggtggtcgccctcggttac
gttctgaagtcaggcaagcttgaggggcctgttgacatgttcgatgatccggccttcgac
tacgccaggcgcgttgcaggggagatgacggatcacctcaggaggatgggcccattcgag
ccccacaggcttccggaccaggagatggagtacactacgctccccgtggtcatggagaag
ctcaaggacaggtttgttgacatagagaaggaaacgctggccaaataa

DBGET integrated database retrieval system