KEGG   Thermoplasma acidophilum: Ta1436Help
Entry
Ta1436            CDS       T00037                                 

Definition
(GenBank) probable lipoamide acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00010  Glycolysis / Gluconeogenesis
tac00020  Citrate cycle (TCA cycle)
tac00620  Pyruvate metabolism
tac01100  Metabolic pathways
tac01110  Biosynthesis of secondary metabolites
tac01120  Microbial metabolism in diverse environments
tac01130  Biosynthesis of antibiotics
tac01200  Carbon metabolism
Module
tac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ta1436
   00020 Citrate cycle (TCA cycle)
    Ta1436
   00620 Pyruvate metabolism
    Ta1436
Enzymes [BR:tac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ta1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAC12556
UniProt: Q9HIA5
Structure
PDB: 

Position
complement(1485462..1486664)
Genome map
AA seq 400 aa AA seqDB search
MYEFKLPDIGEGVTEGEIVRWDVKEGDMVEKDQDLVEVMTDKVTVKIPSPVRGKIVKILY
REGQVVPVGSTLLQIDTGEEAPVQQPAGRAESTVQVAEVKQVPLPEVSGHVLASPAVRRI
ARENGIDLSKVGGTGEGGRVTLDDLERYMKSPAPSPAPSAGKAEAVHTAPQIPAQKPAPG
REEILEMHGLRRIIFDKMTKAKQIMPHFTVMEEVDVTSMVSILDSAKARNRKVTVTGFLA
RIVPSILKQYPYLNAIYDETRRVYILKKYYNIGIAVDTPDGLNVFVIKDADRKSMVEISA
EISDKASRARENKLQLDEVQDSTFTITNVGTIGGIMSTPIINYPEVAILGVHRILEREGR
KYMYLSLSCDHRLIDGAVATRFIVDLKKVIEDPNAIIYEI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaattcaaactgccagacataggtgagggggtaacagagggcgagatagtcaga
tgggatgtcaaggaaggcgacatggtggagaaggatcaggaccttgttgaggttatgacg
gacaaggtcacagtgaagataccgtcgcccgtcaggggaaagatagtgaagatactctac
agggagggccaggttgtccctgtgggttctaccctcctgcagatcgataccggtgaagag
gctccggtacagcagcctgccggccgtgccgaaagcacggttcaggttgcagaggtcaag
caggtgcccctgccggaggtatccgggcatgtgcttgcaagccctgcagttaggagaata
gcgagggagaacggaatagacctctcgaaggtgggaggcaccggagagggtgggcgcgtg
acgcttgacgatctggagaggtacatgaagtcgcctgcaccatcgccagccccatccgct
ggaaaagcggaggccgtgcacacggcgccgcagatcccggcccagaagcctgcacctggg
agagaagagatcctggagatgcatggcctgaggcggataatattcgacaagatgacgaag
gcaaagcagatcatgccccatttcacggtgatggaggaagtcgacgtcacatccatggtt
tcgattctggattccgcgaaggccaggaacaggaaggtcaccgtcacgggctttctggca
aggatcgtgccatctatcctgaagcagtatccatacctcaacgcaatttacgatgaaacg
cgcagagtttacatactgaagaaatactacaacataggcatagcggttgacacgccggac
ggcctgaacgtcttcgtcataaaggatgctgatagaaagagcatggtggagatatctgca
gagatatcggacaaggcaagcagggcacgcgagaacaagctgcagctggatgaagtccag
gattcaacgttcaccataaccaacgttggcacaatagggggcataatgtccacgccaata
atcaactatcctgaggtcgcaatactgggtgtgcaccggatcctggaaagagaggggcgg
aaatacatgtacctatcgctgtcctgtgaccacaggctcatagacggagcggttgcaacc
aggttcatcgtggatctgaaaaaggttattgaggatccgaacgctataatctacgagatc
tga

DBGET integrated database retrieval system