KEGG   Thermodesulfobium acidiphilum: TDSAC_0453Help
Entry
TDSAC_0453        CDS       T05396                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
taci  Thermodesulfobium acidiphilum
Pathway
taci00010  Glycolysis / Gluconeogenesis
taci00020  Citrate cycle (TCA cycle)
taci00620  Pyruvate metabolism
taci01100  Metabolic pathways
taci01110  Biosynthesis of secondary metabolites
taci01120  Microbial metabolism in diverse environments
taci01130  Biosynthesis of antibiotics
taci01200  Carbon metabolism
Module
taci_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:taci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDSAC_0453
   00020 Citrate cycle (TCA cycle)
    TDSAC_0453
   00620 Pyruvate metabolism
    TDSAC_0453
Enzymes [BR:taci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     TDSAC_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AWB09828
UniProt: A0A2R4VZH1
Position
complement(442584..444119)
Genome map
AA seq 511 aa AA seqDB search
MRGDELKAMSNFIPKNVRSIKKNLSVPELIELAIKNGEGVLSSDGSLCVRTGKFTGRSPN
DRFIVYDDITKDTVDWGKINLPLPEENYKIIKSKASAYMQNKDILEFSGSVGADPDYQFN
VHIFCEYAFSALFSKFLFINSKNKIAKNSFTMFVLPGFSVDPETDKTNSDAAIILNLKEK
TIIISGSMYCGEIKKAIFTCMNYFLPEKEVLPMHCSANIGKNNDVALFFGLSGTGKTTLS
NDPERKLIGDDEHGWSENGIFNFEGGCYAKCINLSRENEPIIYNSIKFGSLLENVILTKD
RTPDYTDSSITENTRAAYPMKAVSIAHDKLYGPHPKCIIFLTADAFGVMPPVAKLSPQDA
RDYFLCGYTSKLAGTERGIIEPQTTFSFCFGAPFMPRKPIEYASLLEKKIREHSVRIYLL
NTGWIGGPFGIGKRIDIKTTRTIVKHIIEGTIENSKFIKDKYFGLTIPEYLEGIAPEILN
PINSWENKEEYTKKAIELAKKIENQIKKHKE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
ttgcggggtgacgaattgaaagcgatgtcaaactttattccaaaaaatgttagaagtatt
aaaaaaaaccttagcgtcccagaactaatagaactagccataaaaaatggcgagggggta
ttatcgagcgacggttctctttgtgttagaacaggcaagtttacaggcagatccccaaac
gatagatttatagtttatgacgatataactaaagatactgttgattggggaaagataaac
ctacctctaccagaagagaactacaaaattataaaatcaaaagcttcggcttatatgcaa
aataaagatattttagaatttagcggctctgtaggagcggatccagattatcaatttaac
gttcacattttttgcgaatatgccttttcagctcttttttcaaaatttttgtttataaat
agcaaaaacaaaatagcaaaaaattcttttacaatgtttgttttaccaggtttttctgtt
gatccagaaactgacaaaactaactctgatgcagcaataattcttaatctgaaagaaaaa
acaataataatatctggaagtatgtattgcggagaaataaaaaaagcaatatttacctgt
atgaattattttctaccagaaaaggaagtccttccaatgcattgcagtgcaaatattgga
aaaaacaacgatgtagcacttttttttggactttctggtacaggaaaaactaccctatct
aacgacccagaaagaaagttaattggcgacgatgaacacggctggtccgaaaacggaatt
tttaattttgaaggtggctgttatgctaagtgtattaatctatctcgtgaaaacgaaccc
ataatctataattcaatcaaatttggtagtctattagaaaatgtaatccttactaaagat
agaactccagattacacagattcatctatcacagaaaatacaagagctgcatatcccatg
aaagcagttagcatagcccacgataaactatacggtccacatccaaaatgcattattttc
ctcacagcagatgctttcggagttatgccaccagttgcaaaactaagccctcaagatgcc
agggattactttttatgcggttatactagcaaattagcaggcacagaaagaggaataatt
gaaccacagactaccttctctttttgttttggagctccatttatgccaagaaaaccaata
gagtatgcctcattacttgaaaagaaaataagggagcatagtgtaagaatatacctctta
aatactggctggattggtgggccatttggcattggcaaaagaatagatatcaaaactaca
agaactatagtaaaacatataatcgaaggaacaattgaaaactcaaaatttataaaagac
aaatactttggacttactataccagaatatcttgagggcatcgcaccagaaatactaaat
ccaataaattcctgggagaacaaagaagagtatacaaaaaaagctattgaattagcaaaa
aagattgaaaatcaaatcaaaaaacacaaagaatag

DBGET integrated database retrieval system