KEGG   Thermodesulfobium acidiphilum: TDSAC_0705Help
Entry
TDSAC_0705        CDS       T05396                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
taci  Thermodesulfobium acidiphilum
Pathway
taci00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:taci00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TDSAC_0705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:taci01007]
    TDSAC_0705
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:taci03016]
    TDSAC_0705
Enzymes [BR:taci01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     TDSAC_0705
Amino acid related enzymes [BR:taci01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TDSAC_0705
Transfer RNA biogenesis [BR:taci03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TDSAC_0705
 Prokaryotic type
    TDSAC_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AWB10073
UniProt: A0A2R4VZT5
Position
670486..671955
Genome map
AA seq 489 aa AA seqDB search
MLNNQIYLYNTLTKRKEKFLPIENRKIRMYVCGVTVYDYCHLGHGRSYVVWDVWKRFFLS
QGFDVFHIQNFTDIDDKIIKRSKEEKIDWKELTNKFIDAYFEDMDKLNVLRATLYPKATD
YIDDMIKIIIGLIEKGYAYKAGEDIVFSIKKFKDYGKLSGKSIDDLIKNYRVDSSSYKEN
PLDFVLWKASKPGEPFWESPFGQGRPGWHIECSAMSLKHFGSPFDIHAGGQDLIFPHHEN
EIAQSEGFTGKKFVNYWLHNGFVTISGEKMSKSLGNFKTLRDIYQEYDPMVLRLFILSSH
YRSPVVFNLENLMAAKEAWDKIKNAVDVCSSLGLIGELKVALPNNFIAALCDDLNTPLAI
SYIFEKVRLINSLVDSYLKSQATDVKSTVSSNISEVLSMIEILGLKYKPDVLFYSKEQLS
KEFGSYNSTEVNFESFDELTTENIFKLLSFREFLKKRELYESADKIRDFLNKKGIVIEDL
PGGIRVKKR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaacaatcaaatatatctctataatacattaacaaaaagaaaagaaaagttttta
ccaatagagaatagaaagattagaatgtatgtttgtggtgttacagtctatgattattgt
catctaggacatggaagatcttatgtagtctgggatgtctggaaaagattttttttgagc
cagggatttgatgtatttcatattcaaaattttactgatattgatgacaaaataataaaa
agatcgaaagaggaaaaaattgattggaaagaacttacaaataaatttatagatgcatat
tttgaagatatggataaattaaatgttttaagagcgaccctttatccaaaagctactgat
tatattgatgatatgattaaaataattattggtttaatagaaaagggttatgcctataaa
gctggtgaagatatagtcttttctataaagaaattcaaagactatggaaaattatctgga
aaatctatagacgatttaattaaaaactatagagttgattcatcatcttacaaagaaaat
cctttggattttgtgttatggaaagcatcaaagccaggtgagcctttttgggaaagccca
tttgggcaagggaggccaggatggcacatagaatgttctgcaatgtctctgaaacacttc
ggttctccatttgatattcatgctggtgggcaagatttaatttttcctcatcacgaaaat
gaaattgcacaatcagagggttttactgggaaaaaatttgtaaattattggttgcataat
ggctttgttactatatctggagaaaaaatgtcaaaatctcttggaaattttaaaacctta
agagatatttatcaggaatatgatccgatggttttaaggctttttatactgagtagccat
tatagaagcccagttgtatttaatttagaaaatttaatggctgcgaaagaggcttgggat
aaaattaaaaatgctgttgacgtatgttcttctctcgggcttataggagagcttaaagta
gctttgccaaataattttattgccgctttgtgtgacgatctaaatactccgttagctatt
tcttatatttttgaaaaagttagacttattaattcgcttgtagatagttatttgaaatca
caagcaacggatgtgaaaagcactgtttcttctaatataagtgaggttttgtctatgatt
gaaatattgggtctaaagtataagcctgatgttttattttattctaaagaacagttgtct
aaagaatttggctcttataattctactgaagtaaattttgaatcatttgatgaacttact
actgaaaacatttttaaacttctgagttttagagagtttttaaaaaagagagaattatat
gaaagtgctgataaaataagggactttttaaataaaaaaggaattgtaatagaagatttg
ccaggaggcataagagtaaaaaaaagatga

DBGET integrated database retrieval system