KEGG   Thermodesulfobium acidiphilum: TDSAC_1779Help
Entry
TDSAC_1779        CDS       T05396                                 

Definition
(GenBank) adenosylmethionine-8-amino-7-oxononanoate aminotransferase apoenzyme
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
taci  Thermodesulfobium acidiphilum
Pathway
taci00780  Biotin metabolism
taci01100  Metabolic pathways
Module
taci_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:taci00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TDSAC_1779
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:taci01007]
    TDSAC_1779
Enzymes [BR:taci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     TDSAC_1779
Amino acid related enzymes [BR:taci01007]
 Aminotransferase (transaminase)
  Class III
   TDSAC_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AWB11115
UniProt: A0A2R4W2X3
Position
1751352..1752674
Genome map
AA seq 440 aa AA seqDB search
MIQIWHPCTQMKDHEKYPLIKIKNARGVYLYDFNGNSYIDGISSWWVNLFGHSNERLNRA
ISNQIASLEQIIFAGFTHEKALELAKLLSEVVPDNLSKMFFAETGSSAVEISIKMSYHYF
QNIGQRKRKKFVSLKNGYHGETIGALSVSGEDLYKKAYKSILPKNIVSFSPDCYRCKFGH
SRESCNTECFSDIEKILISNGEKICAVIVEPIVQFAGGFKIYPPEYLVKLRNLTSKLGIH
LILDEIATGFGRTGKMFACEWADIKPDFMCLSKGITSGYLPLSVVLTTDEVYRAFYDDYT
TLKAFLHSHSYNGNAISSAVAVETLKIFKEENVLEKNKEKYKYMRNLIENKFCELQHVGE
IRHIGFISAVEIVENKKTKKPFNWKKRTGFNIYREALKRGVLLRNLGDIIYFLPPYIIEP
HQIEFLVKAAHQSYLEVLKK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgatacaaatttggcatccttgtacacagatgaaagatcacgaaaaatacccgttaata
aaaataaaaaacgcaaggggggtttatctttacgactttaatggtaattcttacattgat
ggaatatcttcctggtgggtaaacctctttgggcattccaatgaaagattaaacagagct
atttctaatcagatcgcttcacttgaacaaataatttttgctggctttacgcacgaaaaa
gctttagaactagcaaagcttctttctgaggttgttccagacaatctttctaaaatgttc
tttgcagaaactggttcaagtgcagtagaaatttcaattaagatgagctatcactatttt
caaaacataggacaaagaaaaagaaaaaaatttgtatctttaaaaaatggttatcacggc
gaaactataggcgcactttctgttagcggtgaagatttgtacaaaaaagcttataaaagt
attttgccaaaaaatattgtatccttttctccagattgttataggtgtaaatttgggcat
tcaagagagtcttgcaacacagagtgcttttcagatattgaaaaaatattgatatcaaac
ggcgaaaagatatgcgcagtaatagttgagcccatagtacagtttgctggcggcttcaaa
atttatccgcctgagtatttagtaaagctaagaaatctcacttctaagcttggaattcat
ttaatccttgacgaaatagcgactggctttgggagaactggtaagatgtttgcgtgtgaa
tgggcagatattaaacctgattttatgtgcctatcgaaaggaataacaagcggctatctg
cctctttcagtagtgcttacaactgatgaagtatacagggctttttatgatgattacaca
actcttaaggcatttctgcacagtcacagttataatggtaatgccatatcctcagctgta
gctgttgaaaccttaaaaatatttaaagaagagaatgtgttggaaaaaaataaagaaaaa
tacaaatatatgagaaatcttatagaaaataaattctgtgaactgcaacacgtaggagaa
atcagacatattggatttattagcgctgtggaaattgtagaaaataaaaaaacaaaaaag
ccctttaactggaaaaaaagaactggattcaatatttacagagaagcgcttaagaggggg
gtattgctcagaaacttaggagatataatctactttctcccaccgtatataatagaacct
catcaaattgagttcttggtaaaggcagcacaccaatcatatttggaggtgttaaagaag
tga

DBGET integrated database retrieval system