KEGG   Trichoplax adhaerens: TRIADDRAFT_20134Help
Entry
TRIADDRAFT_20134  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
tad  Trichoplax adhaerens
Pathway
tad04120  Ubiquitin mediated proteolysis
tad04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TRIADDRAFT_20134
   04120 Ubiquitin mediated proteolysis
    TRIADDRAFT_20134
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tad04121]
    TRIADDRAFT_20134
Enzymes [BR:tad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     TRIADDRAFT_20134
Ubiquitin system [BR:tad04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   TRIADDRAFT_20134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD
Motif
Other DBs
NCBI-GeneID: 6748967
NCBI-ProteinID: XP_002108548
JGI: 20134
UniProt: B3RJZ8
AA seq 160 aa AA seqDB search
MLNFNLLTELQRKPTEGFSAGLQDDDIFKWAVMIIGPPDTPFEGGFFKAHLDFPRDYPQR
PPVMQFQTKIYHPNVDKDGKVCISILHEPGEDKFGYEKSSERWRPIHTVETILLSVISML
ADPNDESPANIDAAKDWRENKEKFKRLVAQCVRESQTSYD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttaaattttaatcttcttacagaacttcaaaggaaacctaccgaaggattttccgca
ggattgcaagacgatgacatttttaaatgggcagtaatgataattgggcctcccgacacg
ccatttgaaggaggcttctttaaagctcatctagatttccctagagattatccacaacgc
cctccggttatgcaatttcaaactaaaatttatcatccaaatgtcgataaggacggcaaa
gtttgcatatcaatactacatgaaccaggagaggataaatttggttacgaaaagtcatca
gaaagatggagacctattcataccgttgaaactatacttttaagtgttatttctatgttg
gctgatccgaatgatgaatctccggccaatattgatgcagctaaggactggagggaaaat
aaagaaaaatttaagagattggtagcgcaatgtgtaagagaaagtcaaacgtcatatgat
taa

DBGET integrated database retrieval system