KEGG   Trichoplax adhaerens: TRIADDRAFT_20384Help
Entry
TRIADDRAFT_20384  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
tad  Trichoplax adhaerens
Pathway
tad00030  Pentose phosphate pathway
tad01100  Metabolic pathways
tad01200  Carbon metabolism
Module
tad_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tad_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TRIADDRAFT_20384
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     TRIADDRAFT_20384
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     TRIADDRAFT_20384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C Glucosamine_iso G6PD_N TENA_THI-4
Motif
Other DBs
NCBI-GeneID: 6749944
NCBI-ProteinID: XP_002108730
JGI: 20384
UniProt: B3RLE2
AA seq 793 aa AA seqDB search
MTNSSIIVRHRNIFLWLFISACLIKVSSSTEKASRTNVVLVGATGNLAQKYLWKSLFNLY
KSINQSEEKYQLKFYGAARNPAHEGDKLLDQILGNIFQFDKSGEDEKVQKFLSNCQYVQL
KSEKDYANLCKKINQEAMKESILEYGRIFYLSVPPFAYSRIASYISNHCRPDQESKTWIR
VVFEKPFGQDLQTSKDLTNELQRYFDEHQIYLVDHYLGKVGVDQVLQFRMENLPLYEPLW
NRDYISRIEIVMKEEENCAERTEFYNSYGVIRDVMQNHLTEILALVCMELPGHQMAYNPS
DLLQLKADLLEKVKNLGPDNVIVGQYKDYISHLRQDFKDITKRSNASTFAAVLLQVDNSR
WRDVPIIMVAGKELTERTAYVRVVFKDGLYCLNNEVNCPTAEVIFNIQGGSLGISAEVTS
KLLPRPILRPDWYSTNPTINSGDSLGVRISDYYVRSPKINPDAYTVVVDAVFKGRQDMFI
STKNLILSWTLWTPLVHHADVIIPRLYDKEDNSQTLRFIFHKDQIAFADRFTYDCKNRVK
NLYSKDGNHPFDIINQGFRNQTLIRGSPDAVIDNLVNDILLSATVAIRNRNVFHVAFPGG
STPIPLFQKLASLGSRISWSKWHIWIVDERCVPVLDSRSNFKSLHDHLLRYIDVPYYNIH
PAIANQHTGFCDSSYYEQEIRSVMNESIFDYIVLGVGSDGHIASLFPGFLHTIEANNFVA
LVKKDYADSARITMTFSLLNKARTISALILGKRKQVIVSAIKSGIIDIHRYPVTGIKISD
DRFKWFIDYVALP
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgactaattcttcgataatagttaggcatcgaaacatatttctttggctatttatctcc
gcctgtttaataaaagtcagctcgagtactgaaaaagcttcaagaacgaacgtagttctt
gtcggtgctaccggtaatttagctcaaaaatatctttggaagagtctctttaacctatat
aaaagcattaatcaaagcgaagaaaagtaccagctaaaattttatggagctgctcgtaat
cctgcacatgagggcgacaaattgcttgatcagatacttggaaatatttttcaattcgac
aaatctggagaagatgagaaagtgcaaaaatttttaagcaattgtcagtatgtacaactt
aaaagtgaaaaggattatgcaaacctttgcaaaaaaatcaatcaggaagcaatgaaagag
tcgatattggaatatggtaggatattttatctatcggtacctccgtttgcatactcgcgt
attgcatcctatatcagtaatcattgtagacctgaccaagagagtaaaacatggatacgt
gtagtttttgagaaacctttcggtcaagatttacaaacatctaaagacttgacaaatgag
ttacaacgctattttgacgaacatcaaatctatttggtcgatcattacttaggtaaagtc
ggggttgatcaagttttacaattcaggatggaaaatttaccattgtatgaaccactgtgg
aatcgagattacataagcaggatagaaatcgttatgaaggaagaggaaaattgtgccgaa
agaaccgaattttataactcatatggagttatacgtgatgtcatgcaaaaccacttgaca
gaaatactggccttggtttgtatggaattaccaggtcatcaaatggcttacaacccaagt
gatctactgcaattgaaagcggatttgttggagaaggtgaaaaatttaggacctgataat
gtaattgtgggacaatataaggactatatatcacatttaaggcaagatttcaaagatata
acgaaaagaagtaatgcttctacatttgctgcggtattattacaagtagataattcacga
tggagagatgttcctatcattatggttgcaggtaaagaactgactgaaaggacagcttac
gtaagagtagtttttaaagatggtctttactgtctgaacaatgaagtaaactgtcctact
gctgaagttattttcaatatccaagggggttctttaggaatctcagcagaagtcacttct
aaactactaccacggccaattttacgacccgattggtattcaaccaatcctactattaat
tctggtgattctttgggtgttcgcatatctgattattatgttcgtagtccgaaaatcaac
ccagatgcttatacagttgttgttgatgctgtttttaaaggtagacaagacatgtttata
tctacgaagaatctaatcttatcgtggactttgtggactccactagtacaccacgccgac
gtaattatacctagattatacgataaagaagataacagccaaacgttaagatttatattt
cataaagatcagattgcatttgctgacagatttacttatgattgcaagaatcgggtcaaa
aatttgtattcgaaagacgggaatcatccattcgatattataaatcaaggttttcgaaat
cagacgttaattcgaggttctccagatgcagttatagacaatctcgtcaacgatatttta
ttgtctgcaactgttgctatccgcaatagaaatgtttttcacgttgccttcccaggtgga
tccacgccaatacctctctttcaaaagttggcttccttaggcagccgaatatcctggtcg
aaatggcacatctggatagttgatgagcgttgcgtgccagtattggatagtagatcgaat
ttcaagtcccttcatgatcatttactacgctatattgacgttccatactataatattcac
cctgcaattgctaatcaacatactggcttttgtgattccagttactatgaacaagaaata
agaagtgttatgaatgaatctatttttgattatattgtccttggagttggatcggatgga
cacatagcttcactttttccaggtttcctgcatacgattgaggcaaacaacttcgtagct
ttagtgaaaaaggattacgctgattctgcgaggataactatgacgttttcactgctaaat
aaagcgcgtacaatttcagcattaatacttggtaaaagaaagcaagtcattgtaagcgct
atcaaaagtggcattatagatattcatcgctacccagttaccggtattaagatttctgat
gatcggtttaagtggtttattgactatgttgcattaccatag

DBGET integrated database retrieval system