KEGG   Trichoplax adhaerens: TRIADDRAFT_21436Help
Entry
TRIADDRAFT_21436  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K05635  laminin, gamma 1
Organism
tad  Trichoplax adhaerens
Pathway
tad04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    TRIADDRAFT_21436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 6750474
NCBI-ProteinID: XP_002109259
JGI: 21436
UniProt: B3RNB7
AA seq 991 aa AA seqDB search
MRPESLQIDKKTTLSSPWQTYQYFSQSCTKTYNLPVSEIRKSTFATNKTKVICVQGSTEI
TPFTGGTITFDATAGRAETRADFLQNPELSDWVTVSALKIELRRLNTFGDDNFGDENSYF
YAISDIVVGGRCKCNGHGASCYYDNSNTLTCRCQHNTQGRDCQSCQSKFNDRPWAAATDS
EANECIECKCNGLAESCNFNRTLYEATGSGGICVGCRNGATGINCQKCLSAYYPIDRNDP
SKGCQNCSCNAVGSLNSVCDSMGRCRCKPGVAGDKCDRCQAFYYNFTSAGCSSCDCSEAG
TRADSSDCDKITGQCQCKVNVIGKQCDRCITSHFALSVDNPEGCQRCFCFQHGTECLSAS
NYKQSMIKSDFQQGFDGWRITDDKGRIIVGDFLAFNWTIGSVSATVVRADSPLAYFYAPL
KFRGDQRYSYGKSLRISISATAPNTTSFILTSLDVQILGGIGNSKRLVSSSLSRVNQSQI
LPSNQIRWYDLRLHEGPTYGWSPSLSSIEFQSILYNIEQVIIIAKFSGLLNSVVRLHNVT
LQSAELINNQELSSSYILANYVEECTCAKPYGGLSCQLCADGYRRDQFGGTVYTECVPCQ
CNNQAATCNTTMCHCLNHTAGTFCENCQSGYYGEATDGGFCSRCPSVCNLSKVGAGGECL
KDDQNKIICTNCRRGYAYPQCIHCSDGYYGDPAGIRGVVTPCQQCQCNGNIDPNAVGNCN
RTTGECYKCIYNTEGFYCQQCLINYYGNALSPLKGKQCKACNCHPFGTNSFRNATSPCNR
ITGQCSCRKNVINRDCSQCKANFWGINSGEGCISCKNCSKTGSVGCDQITGDCLCKPNVG
GELCDRCLHGFYNFSIEGCTACRCDPFGIYNTSNGRQCFENGTCTCRSTTIIGEKCDQCV
INHHSLRVYSPQQPCQECDQCYGQFVKTYVNQRRTELLNLQEIIAVLLYNPTSLINVTQF
EIRVEAANGSIQQLLNAMQVVVQQDIQMYTT
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccagaatcgttacaaatcgataaaaaaacgacattatcttcgccatggcaaact
taccagtacttttctcaatcatgcactaaaacgtataatttaccagttagtgaaattcgc
aaatcgacattcgctacaaacaaaaccaaagtaatctgcgttcaaggcagtacggaaatt
acaccgttcacaggtggtacgattaccttcgatgccacagctgggcgggccgaaacacgg
gcagattttctacaaaacccagagttgtctgattgggtaactgtttcagcgttaaaaatc
gaattacgtcgattaaatacttttggtgatgataattttggcgatgaaaatagctatttc
tacgcaatatctgacattgtagtcggcggaagatgtaagtgtaacggtcacggcgcttca
tgctattacgataatagtaatacattaacttgcagatgtcagcataatactcaaggcaga
gactgccaaagctgccaaagtaaatttaatgatcgaccatgggccgccgcaacagattcg
gaagctaacgaatgtattgagtgtaaatgcaatggtttagctgaaagttgtaacttcaac
cgaacgttatacgaagctacgggtagtggtggaatatgtgttgggtgtcgaaatggcgca
acaggcataaattgtcaaaagtgtctatctgcatactatcctattgatagaaatgaccca
tcgaaaggatgccaaaattgcagttgcaatgccgttgggtctctcaattctgtatgtgat
tcgatgggacgatgtcgctgtaaacccggtgtagctggcgataaatgtgatcgctgtcaa
gctttttattacaattttacatcagcgggctgtagctcatgtgattgttcagaagctggg
accagggcagatagtagtgattgcgataaaatcacaggccaatgccaatgcaaagttaac
gttattggaaaacaatgtgatagatgcatcacctcacattttgctctctcggttgataat
cctgaaggttgtcagagatgtttttgttttcagcatggtactgaatgtctctcagcctcc
aattacaaacaaagtatgatcaaatctgattttcagcaagggtttgatggctggcgaata
acggacgataaaggaagaatcatcgtaggagattttctagcatttaactggacgatagga
tcagtctcagctacagtcgttagagctgattcgcctttagcttacttttatgctcctcta
aaatttcgcggcgatcagcgttactcctacggtaaaagtttaagaattagcatcagtgca
actgcccctaacaccacttccttcattctaacatcactagatgttcagatattaggaggt
atcgggaattccaagcgccttgtttcttcatcattaagcagagtcaaccaaagtcaaata
ttaccttctaatcaaataagatggtatgatttacgattgcatgaaggtccgacatacggt
tggtctccatccttatcgtccatcgaatttcaaagtattttatacaatatcgaacaagtt
atcattattgccaaattttctggtcttcttaattccgtagtcagactacataatgtaaca
ctacaatcagcagaattaatcaataatcaagaactttcctcatcatacatattagctaat
tacgtggaggaatgtacctgtgcaaagccttatggaggcttgtcctgtcaattatgtgca
gatggttacaggcgtgatcaatttggtggaacggtttatacggagtgtgttccttgtcaa
tgtaacaatcaagctgcaacatgcaatactactatgtgtcactgcctcaaccatacagcc
ggaacattttgtgagaattgccaatcaggctattacggtgaggccacagatggtggtttc
tgtagtcgttgtccatcagtgtgcaaccttagtaaagtgggagcgggtggtgaatgcttg
aaagacgatcagaataaaatcatttgtactaactgtcgtagaggatatgcttacccgcaa
tgcatacactgtagcgacggttactatggcgatcctgccggtattcgcggcgtagtaact
ccatgtcaacaatgtcaatgtaatggtaatattgatccgaatgctgtaggaaattgcaac
agaactacaggagagtgttacaagtgcatttataatactgaaggattttattgtcaacag
tgtctgattaattattacggaaatgctctgtcaccccttaaaggaaaacaatgtaaagcc
tgcaattgtcatccctttggcactaattcattcagaaatgctacttcaccgtgcaacaga
attacgggacagtgctcttgtcggaaaaatgtaataaaccgagactgtagccaatgcaag
gctaacttctgggggattaattcaggagaagggtgtatctcttgtaagaattgcagcaaa
acaggatctgtaggttgcgatcaaataacgggtgactgtctttgtaagccaaatgttggg
ggcgagctgtgtgatagatgtctacatggtttttataatttttccattgaaggatgcaca
gcttgtagatgcgatccctttggaatttataatacttcaaatggaagacaatgtttcgag
aacggaacatgtacttgccgatcgaccaccattataggcgagaagtgtgatcagtgtgta
attaatcatcattctttgcgagtctattcgccacaacagccttgtcaagaatgcgatcaa
tgctatggtcaattcgtaaaaacttatgtcaaccagcggagaacagagttgctaaatctt
caagaaattatcgctgttttattatacaatcctacatcattaattaacgtcacccagttc
gaaattagagtcgaagcagctaatggcagcattcaacagttattaaacgcgatgcaggta
gtcgttcaacaagatatccaaatgtacacaacgtaa

DBGET integrated database retrieval system