KEGG   Trichoplax adhaerens: TRIADDRAFT_21872Help
Entry
TRIADDRAFT_21872  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
Organism
tad  Trichoplax adhaerens
SSDB OrthologParalogGFIT
Motif
Pfam: SGT1
Motif
Other DBs
NCBI-GeneID: 6750422
NCBI-ProteinID: XP_002109768
JGI: 21872
UniProt: B3RN05
AA seq 633 aa AA seqDB search
MENLSNLKIAGNTVEYRIYSADLLTSQDVPKCNEQLQDRRSQYITYLRSYLVEYIWHNES
FNLRVIPPTAACPAHLYGSTEFADNIDDEWFIVFLLWKITSTWDDVIVSIWDNDEQFLLI
EAANDLPSWLEPNTSDNRVFIYNGLLQIIPLPNTPAELSSLPVGQLSIGKALAIVTSQKV
NTVASSPIQQAILNRIEEYPEKLVLNKHRAHLYVPANVAYILKTRPGLLSPAVQAFYERD
PLDLKVCRLMKHFPPDTCIKAEITFTRCLYAQLLQQKFKPDKRSSWKLPSQYHPEYKAYE
LGMKLACGFEILCSRHESKSGQTPHTTRALESYLSNLKKHGYFQNEIEGSQKYQMLLDAA
KQYFINPSLGGDIDHPGCEVLNILRTANYKIEDLKRASESLQREDDDSWLELSSQEVDSM
IEKAKGNLDELNTEDLDFEVDDEESKELGNIASGMKSFISKISGYEGAEFPSSKNDCDVD
FDPDAFLQSIYKFTKVHINDNDDLSEQDSDNNDDIEFDSSGKIIYSNLKLYRMSEVQKYM
DQMDQELAPTTMGKSFTKAKDNIDDNGSKMSQDNVGQKDVLDTDDLDNYKPIDVDINLVK
NILESYSAQQGLPGPATNILQSMNIKIPDDAVE
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggagaatctgtccaatcttaaaatcgctggaaacaccgttgaatatcgtatttatagt
gcagacctactgacctcacaagatgtgcccaaatgcaatgaacaactacaggatcggcgt
agtcaatatattacttatcttaggtcgtatctagtcgaatacatctggcataacgaatcc
tttaaccttcgagtgattccacctacagctgcttgtccagctcacctttatggctcgact
gagtttgcagacaatattgatgatgaatggtttatcgtcttcttattgtggaaaataact
tcgacatgggatgacgttattgttagcatttgggacaatgatgagcaatttttactcatt
gaagctgcaaatgacctaccgagctggttagagcccaatactagcgataatagggtcttt
atttataacggtttattacaaatcattcccctacctaacacaccagctgaactctcgtct
ttaccagtcggccaactttcaataggcaaagctttggcaattgtcacgtctcaaaaagta
aatactgtggcgtcttcccctatccaacaggcaattctcaatcgtatcgaagagtatcca
gaaaaattagtattaaataagcacagagctcacctttatgttccagctaatgtagcgtat
atcctaaaaacaagacctggacttctttcaccagctgtacaagcattttacgaacgcgat
cccttagaccttaaggtatgccgcttgatgaagcattttcctcctgatacttgcataaaa
gctgagattacattcacaagatgcttgtatgctcagctgctgcaacaaaagttcaaaccg
gataagcgcagctcttggaaactaccgtctcaatatcacccagaatataaagcttatgag
cttggaatgaaactagcatgcggatttgagatactatgtagcagacatgagagtaaatca
ggccaaaccccgcatactacacgtgcattggagagttatctgtctaatttgaaaaagcat
gggtactttcagaatgagatagaaggttctcaaaagtatcagatgctacttgatgctgca
aagcaatatttcattaatccatcgctgggaggtgatattgatcatcctggttgtgaagtt
cttaatatcctccgaaccgcaaattataaaatcgaagatttaaagagagcgtctgaatca
ttgcagcgggaagacgatgatagttggttagaattgtcatctcaagaagttgatagtatg
attgaaaaggcgaaaggaaacctagatgaattaaatacagaagatttagatttcgaagtt
gacgatgaggagtccaaggagctcggaaacatcgccagcgggatgaaatccttcattagt
aaaatatcaggttatgagggcgccgaatttcctagttcgaaaaatgattgcgacgtcgac
ttcgatcctgatgcatttcttcaatcaatttacaagtttacaaaagttcatatcaacgac
aatgatgacctgtcagagcaagatagtgataataatgacgatatagaatttgattcatca
ggtaagataatatattccaatcttaaattataccgcatgagtgaagtacagaagtatatg
gatcaaatggatcaggagctagctccaacaaccatgggcaagagttttactaaagctaaa
gataacattgacgataacggatcgaagatgtcgcaagataatgttggccaaaaagatgtt
cttgacacggatgatcttgataactataagccgatagatgtagatatcaatttagttaaa
aatattctagagtcatacagcgctcagcaagggttgcctggccctgctacaaatatctta
caatctatgaatatcaagattcccgacgatgcagttgaataa

DBGET integrated database retrieval system