KEGG   Trichoplax adhaerens: TRIADDRAFT_23478Help
Entry
TRIADDRAFT_23478  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K08601  ubiquitin thioesterase [EC:3.4.19.12]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRIADDRAFT_23478
Peptidases [BR:tad01002]
 Cysteine Peptidases
  Family C67
   TRIADDRAFT_23478
Ubiquitin system [BR:tad04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    TRIADDRAFT_23478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH_1
Motif
Other DBs
NCBI-GeneID: 6752813
NCBI-ProteinID: XP_002111600
JGI: 23478
UniProt: B3RVV8
AA seq 295 aa AA seqDB search
FGDFDSPIVKDYIPPPSSLSALMYGDNRGIQGHNNSCYLDCTLFSMFCCSSNFDEMLQPE
NFSNADENLKEIQGCLSSGIVNCLRSHGFVRADRVARFRQILEATGQIKGVLDQEKDPEE
FINFLMNLLWPKKPLLELKLISTNNSYDGNILQILGVRDPRETMPTLQNLYEKSMIFSDI
KFAKVSLMPYRPQTNDCNNNHRIQLNLFAVICISISHYVAFVRCGNKVDSNWCFYDSMFD
RDITGYNIPRVERLDDVATWLSDHRYACEGYLNENVPDRLRRLFEDAYICMYSSD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttcggagatttcgattcaccaatagtaaaagattacattccgccaccatcttcactttca
gctcttatgtatggtgataatcgagggattcaaggtcataacaattcctgttacctggac
tgtacactatttagtatgttttgctgtagctctaatttcgacgagatgctacaacccgaa
aatttttctaacgccgacgaaaatttaaaagaaattcagggttgcctaagtagtggaatt
gttaattgcttaagaagccatggtttcgttcgagctgatcgtgtggctagatttaggcag
attttggaagctactggccagataaaaggtgtacttgaccaagaaaaagatccagaggaa
tttatcaattttttaatgaatctcctgtggccaaagaagccattgctggaattaaaactt
atatcaacaaacaattcgtatgatggcaatattcttcaaattcttggtgtaagagatcca
agagaaacaatgccgacgctgcaaaatttgtatgaaaagtccatgatattttctgatatt
aaatttgctaaggtcagcttaatgccttataggccacaaacaaatgattgtaacaacaat
catagaattcaactgaatttatttgctgttatttgtatctccatatcccactatgtggca
tttgttcgctgtggtaacaaagtcgactcgaattggtgtttctatgacagcatgtttgat
cgtgatattactggttacaatattccccgcgtagaaagattagacgatgtagcaacgtgg
ctaagtgatcatagatacgcttgtgagggctatttaaatgagaatgtaccagatcgttta
cggcgattatttgaagatgcatatatttgtatgtatagctccgattaa

DBGET integrated database retrieval system