KEGG   Trichoplax adhaerens: TRIADDRAFT_23638
Entry
TRIADDRAFT_23638  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
Organism
tad  Trichoplax adhaerens
SSDB
Motif
Pfam: XPG_N XPG_I XPG_I_2
Other DBs
NCBI-GeneID: 6752960
NCBI-ProteinID: XP_002112255
JGI: 23638
UniProt: B3RTZ7
AA seq 247 aa
MGVKGLWKLLESAGQPITLESLENKILAVDISLWLNESLRGMRDHQGSLIENAHLLGLFY
RLCKLLFFKIRPVFVFDGGVPLLKKQTISKLVDVQRSLEEQQTSLIQEHKRQERMAASVS
NEMYSECQELLSLFGIPYIVSPMEAEAQCAVLDFTNQTDGTITDDSDIFLFGGRNIYRYV
FRESKLAEFYDSQRIQRLMGLDRKKMITLAYLLGSDYTDGIKNVGIVMAMELLSTFGDDL
TGLQKIK
NT seq 744 nt   +upstreamnt  +downstreamnt
atgggagtcaaaggcttatggaaattattggaatcggctggacagccgattactctcgaa
tcgctagagaataagatcttggctgtagatattagcttatggctcaatgaaagtttacga
gggatgagagatcatcaagggagtttaatagaaaatgcccatttattgggcctattctat
cgtctgtgcaagctcttattctttaaaatccgtccagtatttgttttcgatggtggtgta
cctctgctaaagaagcaaacgatatcaaaattagtagatgtccaacgtagcttggaagaa
cagcaaacttcgcttattcaagaacataaaaggcaagaaagaatggctgcttctgtttcc
aacgaaatgtattctgaatgccaggaacttctcagtctattcggtattccatacattgta
agtccaatggaagctgaggcccagtgtgctgtattagattttaccaaccaaaccgatgga
acaattacagatgatagcgatatcttcctttttggagggcgcaatatttacagatacgtc
tttagagaaagtaaacttgcagaattttacgattctcagagaattcagaggcttatgggt
cttgatcgtaaaaagatgattactttagcttatctacttggcagcgattacaccgacgga
attaaaaatgttggaattgtgatggctatggaacttcttagtacatttggtgacgacctg
acaggattgcaaaaaataaagtaa

DBGET integrated database retrieval system