KEGG   Trichoplax adhaerens: TRIADDRAFT_25814Help
Entry
TRIADDRAFT_25814  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
tad  Trichoplax adhaerens
Pathway
tad00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tad00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TRIADDRAFT_25814
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tad01007]
    TRIADDRAFT_25814
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tad03016]
    TRIADDRAFT_25814
Enzymes [BR:tad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     TRIADDRAFT_25814
Amino acid related enzymes [BR:tad01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TRIADDRAFT_25814
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TRIADDRAFT_25814
 Prokaryotic Type
   Other AARSs
    TRIADDRAFT_25814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e RNase_T
Motif
Other DBs
NCBI-GeneID: 6753880
NCBI-ProteinID: XP_002112667
JGI: 25814
UniProt: B3RWY6
AA seq 1065 aa AA seqDB search
MADSEQFSFPSEEKKVLSFWKQIDAFQSCLRQSKDKPRYTFYDGPPFATGLPHYGHILAG
TIKDIVTRYAHQSGFHVIRRFGWDCHGLPIEYEIDKQLGIKGPDDVAKMGIKAYNDECRK
IVMRYSSEWQTIVTRLGRWIDFDHDYKTLYPWYMESIWWVFKQIYSKGLVYHGYKVMPFS
TACNTPLSNFESGQNYKDVNDPAVIVSFPLDEDPNIRIIAWTTTPWTLPSNLALCVNAKL
DYVKIRDNATENVYIMMEARLGTLYKTDKEYTILDRFTGDALQGKTYKPLFPYFESMKEQ
GAFVIYCDDYVTDDSGTGVVHQAPFFGEDDYRAAMNFGVIKKGGKVVCPVDPSGKFTDEV
PDFQGLHVKDADKLIIKKLKELGRLVHQSVCKHSYPFCWRSDTPLIYKAVPSWFIRVEDI
IDGLLKNNAKCYWYGVPEFVKEKRFYNWLKGACDWNFSRNRYWGTPIPLWVSEDMQEVVC
VGSIDELEKLSGVRLTDLHRENVDKVTIPSKTGKGVLRRITEVFDCWFESGSMPYAQNHY
PFENKEDFESCFPADFIAEGIDQTRGWFYTLLVISVAMFDKPPYKNLIVNGLVLAADGRK
MSKRLKNYPNPEIIVSNYGADALRLYLINSPVVRGETLKFQERGVKDIIKDVFLPWLNAF
RFLSQNIKQWEQTNGGKFVFNENTFSGSENSKDKWILSFTQSLNQFVRKEMEAYRLYTVI
PRLVRYFDQLTNWYIRFNRKRIKGEADQSSCHSALQTLYSVIYTINRLMASFTPFFTEHI
HQNMRQWLAVESIKDINTDSVHFLMIPQVKESLIDHEIERSVARMQAVIELGRVIRDRKA
LPIKYPLPELIVIHKEKQYLNDVLSLQDYILEELNVRDLVLSSEKEKYGIRLRAEPDNQL
LGKRLKGSFKTVSAAIKELKDHDIAELQEKGELVVNGHTVTIDEIKIAYTVDKEHKIDET
AYEAHSDNDVLVLINVTPDETMLNEGFAREVVNRIQKLRKKAGLQPSNDVTVFYETPKSN
EENQSFLKVITEYKNYIENAIKQPVTHGFARSDDNIIIQDTEVKV
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggccgactcggagcaatttagttttccatcagaggagaaaaaagttttaagtttctgg
aagcaaattgatgcttttcagtcttgtttaagacaatccaaggataaaccaaggtacacg
ttttatgatggaccaccatttgctactggcctacctcattatggtcatatcttagccgga
accattaaggatattgttacgagatacgctcatcaaagtggcttccatgtcatacgaaga
tttggttgggattgtcatggtttgccaattgaatacgaaatagataaacagcttggaatc
aaggggccggatgatgttgcaaaaatgggcattaaagcttacaatgatgagtgtcgtaaa
attgtcatgagatattctagcgaatggcagactattgttactcgacttggtcgttggatt
gattttgaccacgattataagacattatatccatggtatatggaatcgatatggtgggta
tttaaacagatatattcgaaaggccttgtatatcatggttacaaggttatgccattttct
acggcttgtaatactccattatccaattttgagtccggacaaaattacaaagatgtgaat
gatcctgcagttattgtctcgttccctcttgatgaagatcctaatatcaggataattgct
tggacaaccacgccatggacgttgccgagcaatttggcgttgtgtgttaacgcaaaattg
gactacgtgaaaatacgtgataatgctacagaaaatgtatacattatgatggaagcaaga
ttgggtacattatacaaaaccgataaggaatatactatattagataggttcactggagat
gccctgcaaggtaaaacctataagccgctattcccttacttcgaatcgatgaaagaacag
ggcgcttttgtcatatattgcgatgattatgttactgacgatagcggaactggagttgtt
catcaagctccattctttggcgaggacgattatcgagcagcgatgaattttggcgttatc
aagaaaggtggtaaagttgtttgccccgttgatcctagcggaaaatttactgatgaagta
ccagattttcaaggattacatgttaaggatgctgataaattgataatcaaaaagctaaaa
gagcttggtcgcttagttcaccagagtgtttgtaagcatagttatcccttctgctggagg
tctgatacaccgctgatttataaagctgtaccaagttggtttattagagtcgaagatatt
attgatggtttattgaaaaacaatgctaaatgttattggtatggggtaccagaatttgtg
aaagaaaagagattctataattggcttaaaggtgcgtgtgactggaatttttctcgtaat
cgttattggggaacgccgattccattatgggtcagtgaagatatgcaagaggtcgtttgt
gtggggtctatcgacgaattagaaaagctttctggtgtccgccttacagacttgcataga
gaaaacgttgataaggtcaccataccttctaaaaccggtaaaggtgtcttacgacggatt
actgaagtattcgattgttggtttgaaagtggaagtatgccatacgctcaaaatcactat
cctttcgaaaataaagaggactttgaatcttgctttcctgctgattttatcgctgaagga
attgatcagactcggggctggttttatacattgctcgtcatatcggttgctatgtttgat
aagccgccttacaaaaacttgattgtcaacgggcttgttctcgctgcggatggccgtaaa
atgagcaaacggctaaagaattatcccaatcctgaaataattgtgtctaattatggagct
gacgcattacgcctgtacctgattaattctccagttgtaagaggagaaacacttaaattt
caagaacgtggtgtcaaagatattatcaaggatgttttcttgccttggttaaatgcattt
agattcttaagtcaaaacattaagcagtgggaacaaaccaacggtggcaagtttgtattc
aatgaaaatacattcagtggttcggaaaattcgaaagataaatggatattatctttcaca
caatccttaaatcaatttgttcgaaaagaaatggaagcatataggctttatactgttata
ccgcgtttggtaagatattttgatcaattaacaaactggtacatccgattcaaccgaaag
agaatcaagggtgaggccgaccaaagcagctgtcattccgctctccagactttgtattca
gttatttataccatcaacagattaatggcatcctttactcccttttttaccgaacacata
catcaaaatatgaggcaatggcttgccgttgagtccataaaggatatcaacaccgattct
gttcactttttaatgatacctcaagtcaaagaaagtctcatcgatcatgaaattgaaaga
tccgttgctaggatgcaggctgtaattgaattgggtcgtgtcattcgcgatagaaaggct
ctaccgataaaataccctttgccggagttaattgttatacataaagaaaaacagtacttg
aacgacgttctgtccctccaagattatattctcgaggaactgaatgtgagggacttggtg
ttgtcttcggagaaagaaaaatatggtatccgactccgtgctgaacctgataatcaactt
cttggtaaaagattaaaagggtcctttaaaacagtgtcagcagctataaaagagttaaaa
gaccatgacattgctgagttacaagagaaaggcgaattggttgttaatggacatactgtt
accattgatgagattaagatcgcgtataccgtagacaaggagcacaagatagatgagaca
gcgtatgaggcccattcagataatgatgtcctagtgttgatcaatgttacaccagatgaa
acaatgttaaacgaaggttttgctagagaagttgtaaatcgtatccaaaagcttagaaaa
aaggctggattacaaccttcaaatgacgtaacagtgttttatgaaacaccaaagtccaat
gaagaaaaccaaagcttcttaaaagtcattactgaatacaaaaattatattgaaaatgcc
atcaaacagcctgtaacacatggctttgctcgatctgatgataatataataattcaggat
actgaagtcaaggtatga

DBGET integrated database retrieval system