KEGG   Trichoplax adhaerens: TRIADDRAFT_29696Help
Entry
TRIADDRAFT_29696  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
tad  Trichoplax adhaerens
Pathway
tad04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tad00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    TRIADDRAFT_29696
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tad04030]
    TRIADDRAFT_29696
G protein-coupled receptors [BR:tad04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    TRIADDRAFT_29696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 6756842
NCBI-ProteinID: XP_002115529
JGI: 29696
UniProt: B3S5Y6
AA seq 402 aa AA seqDB search
MAIEFGDIRVEAKGFPPLSGNHVAGNQVSNINGRYGQEIDFKTVYIFTVFITGIICNAIV
IATIAYNRQLHSVTNYFIVSQCCADFLFAALVLPAYCLQGLLGYWPFMPEWCAIHACLSI
SLVMTSLLNLFAISLDRYLAICRPYQYHTWMTTRFVIGMLLYIWFQPLLLALIPVFGWRG
VQSTIGSHCVVDLFLYIKQERIYLLIITLINFYIPATIMFTLYILIFKVAIRHIHNIEQQ
RNVQRKQHYFGSIQDQLNHRYLRLAKNDFRLILVFVVVNGAFYLCWTPFMTFGLISLFHL
GPVTDNLGIACSLMAFTNCTLNPIIHNFFNREIRSGFFRMVCFHTRRKPINRSNTHMSGT
QCSSTHGSTFVIRHDLISAKDKAIIEQLVNVSRMKAKKVTYI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagaatttggagatataagagttgaagcaaaaggttttcccccacttagtggc
aatcatgtggctggaaatcaagtgtcgaatataaatggtcgctatggtcaagaaatagac
tttaagacggtttatatctttaccgtattcatcaccggaattatctgcaatgccatcgtt
attgctactattgcttataatcgccaacttcattctgtaactaattattttattgtcagt
caatgttgcgctgatttcttatttgcggctttagttttacctgcatactgtctgcaaggt
ttattaggctattggccatttatgccagagtggtgcgctatccatgcttgcttatcaatt
agtttagtaatgacatcattactcaatttatttgcaataagtctggatcgatatttggcc
atatgtcggccttatcaatatcacacttggatgactacacgcttcgtgattggaatgctg
ctatatatttggtttcagccgcttctgctagccttgattccagtatttggttggagaggt
gttcaatcaactattggcagtcattgcgttgtcgatttatttctatacataaaacaagag
agaatttatttgttaattattacattaattaacttttatatcccagcaacaataatgttt
actttatatatcctgatatttaaagttgctatccgccatattcataatattgaacaacaa
aggaatgttcaaagaaagcaacattattttggatctattcaagatcaacttaatcatcgt
tatttgcgcttagctaaaaacgattttcgattaatacttgtctttgtagttgttaatggc
gcattttatttatgttggacgccatttatgacatttggcttaataagcttattccattta
ggacctgtaactgataacttaggaattgcttgtagtctaatggcgtttacaaattgtaca
ctcaatccgatcatacataacttttttaatcgagaaattcgaagcggatttttcaggatg
gtttgcttccataccagacgcaagcctatcaataggagcaacacgcatatgtcaggcact
caatgttcgtctactcatgggagtacatttgttatacgtcacgatcttatttctgctaag
gataaagcgattatcgagcaactggttaacgtgagcaggatgaaagcaaagaaagtgact
tatatttga

DBGET integrated database retrieval system