KEGG   Trichoplax adhaerens: TRIADDRAFT_30551Help
Entry
TRIADDRAFT_30551  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tad  Trichoplax adhaerens
Pathway
tad00280  Valine, leucine and isoleucine degradation
tad00410  beta-Alanine metabolism
tad00640  Propanoate metabolism
tad01100  Metabolic pathways
tad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TRIADDRAFT_30551
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TRIADDRAFT_30551
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRIADDRAFT_30551
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     TRIADDRAFT_30551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 Utp21
Motif
Other DBs
NCBI-GeneID: 6757460
NCBI-ProteinID: XP_002116155
JGI: 30551
UniProt: B3S7F3
AA seq 360 aa AA seqDB search
MSTSGQRFAAANDEAILEVRNKVGLITLNRPKALNVLSLNMINTIYPIMMEWDKDPNVQV
IVMKGAGEKAFCAGGDVKSLVGNRPLSREFFPTEYRLNNLIGILKTPYVAFIDGITMGGG
IGLSVHGRYRVATERTLFAMPETALGLHPDVGGSYFLPRLEGNLGMYFALTGQRMKGRDV
YFTGIATHYVGSQDINELESKLINQPSITNDVVQEILDQYHKKHEGGEFSFAQHMDKINE
CFKGETIEEIFTLLEKDGSEWAMKCLNHCRKMSPSSMKVTIRALQEGAKAPSLADALLTE
NRICQRMMETKDFYEGVRAILIDRDNNPKWDPATFEEVTDEMVDAHFQPTSDGDVILPKQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatctggtcagcgttttgctgcagccaatgatgaagctattctggaagtacga
aataaagttgggttgataacgctaaatcgacccaaggcattaaatgtgttaagcttaaat
atgatcaatactatttatcccattatgatggaatgggataaagatcctaatgtccaggta
atagttatgaaaggtgctggcgagaaagctttttgtgctggtggtgatgttaaatccctc
gttggcaatcggcccctaagcagggagttctttcctacagaatatcgtttgaataactta
attggcattttgaagactccttatgtagcctttatcgatggaataactatgggtggtggt
attggtttgtcagttcacggccgctatcgtgttgcaacagaacgtacattatttgctatg
cccgaaacagctttgggtctacatccggatgtaggaggatcgtactttttaccacggttg
gaaggcaacttgggcatgtatttcgctctcactgggcaaagaatgaaaggtagagatgtg
tattttactggaattgctactcattatgttgggtcacaagatattaacgaattagaatca
aaacttatcaatcaaccaagtattacaaatgatgtggttcaagagattcttgatcagtat
cataagaagcacgagggtggagaattctcatttgctcagcatatggacaaaattaacgaa
tgcttcaaaggagaaactatagaagaaatatttactctattagaaaaagatggctcagag
tgggctatgaaatgcctcaaccattgtcgtaagatgtcacctagttcaatgaaagtaact
attcgtgcactgcaggaaggagctaaagcgccttccttagctgatgcgttgttaacagaa
aatcgcatttgtcagagaatgatggaaacaaaagatttctatgaaggagttagagctata
ttaatcgatcgtgataataatccaaagtgggatcctgcaacgtttgaagaagtgactgat
gaaatggtcgatgctcattttcaacctactagtgacggagatgtaatattgccaaagcag
tga

DBGET integrated database retrieval system