KEGG   Trichoplax adhaerens: TRIADDRAFT_31020Help
Entry
TRIADDRAFT_31020  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
tad  Trichoplax adhaerens
Pathway
tad00780  Biotin metabolism
tad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TRIADDRAFT_31020
Enzymes [BR:tad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     TRIADDRAFT_31020
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     TRIADDRAFT_31020
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     TRIADDRAFT_31020
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     TRIADDRAFT_31020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C
Motif
Other DBs
NCBI-GeneID: 6757828
NCBI-ProteinID: XP_002116544
JGI: 31020
UniProt: B3S8K6
AA seq 241 aa AA seqDB search
MNVNQDSGLVIIANQQTQGRGRSGNNWISPRGCLMTSIPLTISRRSIIGSRLPLLVNITG
LAVVKAVRSLEGYENIPLGIKWPNDIYYRDEIKLGGIILKSQTIGNNDPQIVVGCGLNVS
NSNPTMCINDIIARFNNRTEGANLKPISVGRLAGLLYNNLETIISNIEKFGIGQFQREYY
KYWIHSNKKVKIANRGNEDFSIAGINDYGFLCVTDRYGQKVTLQPDGNSFDLMRNLITLK
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaaccaggactcgggtttggtaattatagctaatcagcagacacaaggacga
ggtagatccggtaacaattggatttctccgagagggtgtttaatgacttctattccgtta
actatttcacggcgcagcattattggatcgcgattgccattacttgttaatattaccggc
ttagccgttgtaaaggcggttcgatccttggaaggatatgagaacattcccttaggaatc
aagtggccgaatgatatttattaccgcgatgaaataaaactaggcggtataattttgaaa
tcgcagactatcggaaataatgatccacaaattgtcgttggctgtggattgaacgttagt
aatagcaatccaactatgtgcattaacgatattattgcaaggtttaataatcgaacggaa
ggtgctaatttgaaaccaataagtgttggtcggcttgcgggattactatataataatctc
gaaaccatcatttccaacattgaaaaatttggaattggacaatttcagcgagagtattat
aagtactggattcatagtaataagaaggttaaaatcgctaatcgtggtaacgaagatttt
tcaatagccggtattaatgattacggatttctctgtgttactgatcgttatggacagaaa
gtaacgttacaaccggatggtaacagtttcgatctgatgcgaaatctaattacattgaaa
aattaa

DBGET integrated database retrieval system