KEGG   Trichoplax adhaerens: TRIADDRAFT_31114Help
Entry
TRIADDRAFT_31114  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tad  Trichoplax adhaerens
Pathway
tad00450  Selenocompound metabolism
tad00970  Aminoacyl-tRNA biosynthesis
tad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TRIADDRAFT_31114
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TRIADDRAFT_31114
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tad01007]
    TRIADDRAFT_31114
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tad03016]
    TRIADDRAFT_31114
Enzymes [BR:tad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TRIADDRAFT_31114
Amino acid related enzymes [BR:tad01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TRIADDRAFT_31114
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TRIADDRAFT_31114
 Prokaryotic type
   Other AARSs
    TRIADDRAFT_31114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS Anticodon_1 tRNA-synt_1 tRNA-synt_1e GST_C_2 TMEM192 IlvN SNCAIP_SNCA_bd C1_1
Motif
Other DBs
NCBI-GeneID: 6757793
NCBI-ProteinID: XP_002116645
JGI: 31114
UniProt: B3S8S1
AA seq 761 aa AA seqDB search
EEISLADVIIWGTLYPFVDSSPASVNAKKYKSVHTWYQRLSSMDDFKTAVNEATGSKGVT
AFKNYFQQAPIPSVSLSTSQSVTEDSENSVTQDEIDEAYHAWTSGRENYPKREKRPHPLL
PQEGKRNILLTSALPYVNNVPHLGNIVGCVLSADAFARYCRARNYNILYICGTDEYGTAT
ETKAVEEGVTPQQICDKYHALHAEVYKWFDISFDHFGRTTTKEQTEIAQDIFWRLQDRNY
VTEENVDQLFCENCQRFLADRFVEGTCPFCTFPDARGDQCDKCGKLINAIELKAPRCKVC
KSQPVIKSSKHLFLDLPKIEPQLHKYYGRPDSLTDWSPAARNITQTWLRDGVKSRCITRD
LKWGTPVPLEGFTEKVFYVWYDAPIGYISITAAYTDQWEKWWKNPQNVEMYNFMAKDNVP
FHSIIFPACLLAADDNYTVVNKLSATEYLNYEDGKFSKSRGIGVFGNDAKATGIPVDIWR
FYLLYVRPETQDSSFSWSDLEAKNNSELLANLGNFVNRAMLFVSNFFNGEIPEMDLIEED
KVLLAQITREIRTYNNNLERTRIRDGIRNILSVSRLGNQYMQSHTPWKLVKQSEADKKRA
GTVVGVCANITCLLSILLQPYMPTTSKEILSQAKLVDDYSVITDKFVCLLPAGHRIGKPK
HLFEKIEPSKTEEFKTKYGGRTNATAVNFKKTETTPVANDVKELEEQVSKQGDLVRQLKA
DKAEKFVIQSEVQKLLELKKHLAIAKGEPVPSKDSKKKKKK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
gaggaaattagcttagcagacgttatcatttggggtacactatatccttttgttgatagt
agtccagcttctgtcaatgcaaaaaaatataaatctgtccatacttggtatcaacgctta
tcgtccatggatgattttaaaacagcagtcaatgaagccacaggaagtaaaggggtaaca
gctttcaagaattatttccaacaagctcctataccttcagtgtctttatcaacctcacaa
tctgtaactgaagatagtgaaaattctgttacacaagacgaaattgacgaagcgtatcat
gcgtggacatcaggacgtgaaaattatccaaagagagagaaacggccccatcctctctta
ccacaagaaggaaaacgcaacattctattaactagtgcgctaccgtatgtcaataatgta
ccacatttaggcaacatcgttggttgcgttttaagcgctgatgcatttgctagatattgt
cgtgcacgcaattataatatactatatatatgcggaactgatgaatacggaacagcaact
gaaactaaagctgtcgaagaaggagttacgcctcaacaaatttgcgataaataccatgct
ctccacgcggaagtctataagtggtttgacataagttttgatcattttggccgtacaaca
acgaaagaacagaccgaaattgcacaagatatattttggaggctacaggaccgcaattat
gttactgaagagaatgtagatcaactcttttgtgaaaattgtcaaagattcttagctgat
cgttttgtagaagggacttgtccgttttgtacatttcctgatgctcgcggagatcaatgc
gacaaatgtggaaagctcattaatgcaatagaattgaaggcacccagatgtaaagtttgt
aaatcgcagccagttattaaaagctctaaacacttatttttagacctccctaagattgag
ccccaacttcataagtattatggacgaccagattccttgactgactggtcaccagctgct
cgtaacataactcaaacttggcttcgtgatggcgttaagagccgttgtatcacgcgagat
ttgaaatggggtactccagtaccactggaaggctttacagaaaaagtattttacgtttgg
tatgatgctcctataggctatatctccatcactgcggcgtatacggaccaatgggagaaa
tggtggaaaaaccctcaaaatgtggaaatgtacaattttatggctaaagataatgtacca
tttcatagcatcatctttccagcttgtcttttagctgcagatgataattacactgtagtc
aataaactcagtgctactgaatacctcaattatgaagatggaaagttttcgaaaagccgc
ggcattggtgtttttggaaatgatgcgaaagcgactggcattcctgttgacatttggaga
ttttacttactttacgttagaccggaaactcaggatagctcattcagttggtctgattta
gaagctaaaaataattcagaattgttggctaatcttggcaattttgttaatcgtgctatg
ttgtttgtgtccaacttttttaacggcgaaattccagaaatggatttaattgaagaagat
aaggttttacttgctcaaatcactcgtgaaattcgtacatataataacaatttggaaaga
actagaatacgcgatggaataagaaatattttaagcgtttctcgattgggaaaccaatat
atgcaatcccatactccgtggaaacttgttaagcaatcggaagcagacaagaagcgagca
ggaaccgttgttggagtctgtgctaatattacgtgcctgttatcgatactcttgcagccc
tacatgccaactaccagtaaagaaattttgtctcaagcaaagctagtagatgattattcg
gtgatcactgacaaatttgtatgtctattacctgctggccacaggattggcaagccgaag
cacttatttgaaaaaattgaacccagtaaaacggaagaatttaaaacgaaatacggtggt
agaacaaatgcgactgcggtaaattttaagaagactgaaacaaccccggtcgcaaacgat
gtcaaagaattagaagagcaagtttcaaaacagggtgatcttgttcgacaattaaaggca
gataaagctgaaaaatttgtaattcaatcggaagtgcagaaacttcttgaattaaagaag
catctagctatagctaagggcgaaccagtaccaagcaaagacagtaaaaagaaaaaaaaa
aaatag

DBGET integrated database retrieval system