KEGG   Trichoplax adhaerens: TRIADDRAFT_31125Help
Entry
TRIADDRAFT_31125  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K08818  cell division cycle 2-like [EC:2.7.11.22]
Organism
tad  Trichoplax adhaerens
Brite
KEGG Orthology (KO) [BR:tad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tad01001]
    TRIADDRAFT_31125
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tad03041]
    TRIADDRAFT_31125
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     TRIADDRAFT_31125
Protein kinases [BR:tad01001]
 Serine/threonine kinases: CMGC group
  CDK family
   TRIADDRAFT_31125
Spliceosome [BR:tad03041]
 Complex A
  Other components
   Complex A specific factors
    TRIADDRAFT_31125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo IFS
Motif
Other DBs
NCBI-GeneID: 6757804
NCBI-ProteinID: XP_002116528
JGI: 31125
UniProt: B3S8G6
AA seq 513 aa AA seqDB search
MHNQNLDSIKVKTLEEILQEKRNRSRSDSENIAETEDSPGSQFLTDTINFITKNVTSDTK
DETTSAALELDEGEIISSGEENLNHIDDTKPTKRNHASQNDELDDYEEGEIKDRDEVERK
EEFVPAADSSIISNRQISTTKLPPYLPAVQGCRSVEAFEWLNRIEEGTYGVVYRAKDLKS
DEVVALKRLKMEKEREGFPITSLREINTLLKADHPNIVHVREIVVGSNMDKIYIVMEYVE
HDLKTLMESMSQPFSISEVKCLMKQLLSAVQHLHDNWILHRDLKTSNLLLSHQGILKVGD
FGLAREYGSPLKVYTSIVVTLWYRCPELLLGVKEYSTAVDMWSVGCIFGEFLVKKPLFPG
KSEIDQLNKIFKDLGTPNDQIWSGFSELPVAKKVTFTEQPYNRLRDRFGAYLTDQGFDLL
NRFLTYDPKKRISAEDALNHEYFQQEPRPLDPSMFPTWPAKSELMKRPSKANRSPTAPEG
GGMCKIAGAADGFRITYATQGKAAGGAGFNLKF
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaccaaaatttagattctatcaaagtcaaaaccttagaagaaatactacaagag
aaaagaaatcgatctagatcagacagtgaaaatattgctgagacagaagattctccaggt
agccaattcttgactgataccatcaacttcattaccaagaacgtaacctccgacactaaa
gatgaaactacatctgcagctttagagctagacgaaggagagattattagcagcggcgaa
gaaaatttaaaccatatcgatgatacaaaacctaccaagcgaaatcatgcaagtcagaat
gatgaattagatgattatgaagagggagaaatcaaggatagagacgaagttgaacgaaaa
gaagaatttgtgccagccgcagattcgtctatcatttctaaccggcaaataagcacaact
aaattaccaccttaccttcctgccgtccagggctgtagaagtgttgaagcgtttgaatgg
ctaaacagaattgaagaaggtacttatggagtggtttatcgagctaaggacttaaaatca
gacgaagttgttgccttaaaacgattaaaaatggaaaaagaaagagaaggttttccgatt
acttccttaagggagattaatacattattaaaagcagatcatccgaatattgtacacgtt
agagagatagtagttggtagcaatatggataagatctatattgtaatggagtacgttgaa
catgacttaaagactttaatggaatcgatgtcacaacctttcagcattagtgaagtgaaa
tgcttaatgaagcagttattatccgctgtccaacatttacatgataactggatcttacat
cgtgacctgaaaacttccaatttacttctcagccatcaaggcattttaaaagttggagat
tttggtttggctagagagtatggatctcctctaaaagtttacacttctattgtggtaact
ttatggtatcgttgccctgaactacttctgggtgtaaaggagtattctactgctgttgat
atgtggtctgttggctgtatttttggtgaatttctcgtaaagaagccattatttccggga
aaatcagaaattgatcagttgaacaagatttttaaggacttaggcacccctaatgatcaa
atatggtctggattttctgaattgccagttgcaaagaaggtaacttttacggaacagccg
tacaacagacttagagatagatttggagcctatttaactgatcaaggatttgatttatta
aatagatttttgacttacgatccgaaaaagagaatatcagccgaggatgcgctcaatcac
gaatattttcagcaagagccccgacctctagatccctcaatgtttccaacctggcccgcc
aaaagtgaactgatgaaacgccctagtaaagctaatcgaagcccgaccgctccggaggga
ggcggcatgtgtaaaattgcaggcgctgcagatggtttcagaattacctacgctacgcaa
ggaaaagctgctggtggtgctggatttaatctcaaattttaa

DBGET integrated database retrieval system