KEGG   Trichoplax adhaerens: TRIADDRAFT_32175Help
Entry
TRIADDRAFT_32175  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tad  Trichoplax adhaerens
Pathway
tad00040  Pentose and glucuronate interconversions
tad00052  Galactose metabolism
tad00500  Starch and sucrose metabolism
tad00520  Amino sugar and nucleotide sugar metabolism
tad01100  Metabolic pathways
Module
tad_M00361  Nucleotide sugar biosynthesis, eukaryotes
tad_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TRIADDRAFT_32175
   00052 Galactose metabolism
    TRIADDRAFT_32175
   00500 Starch and sucrose metabolism
    TRIADDRAFT_32175
   00520 Amino sugar and nucleotide sugar metabolism
    TRIADDRAFT_32175
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TRIADDRAFT_32175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6758491
NCBI-ProteinID: XP_002117278
JGI: 32175
UniProt: B3SAK4
AA seq 495 aa AA seqDB search
MWNVAEFQAQAKRDSEIAMQHDLDAMLQTAPADQKEASTIMGKELNGFSKLFSRYIENKG
SAIKWDKIRPLPEGAVRKYDDIKVRESEVSRALLDQLVVLKLNGGLGTSMGCTGPKSIIT
VHTNATFLDLTIQQIEFLNDKYNASVPLVLMNSFNTHEDTLKVLRKYKSARVDIHCFNQS
RYPRIYSDNLHPVASQFDDHHDCWYPPGHGDTYAAFSNSGLLEKFLAMGKRYVFISNIDN
LGAVVDMSILNYLASPTDGERCDFVMEVTDKTRSDVKGGTLISYEDKLRLLEIAQVPKDH
VDEFKSIKKFQIFNTNNIWIDMKAIHELYSSNALDMEIIVNNKTMDTTGAHVIQLETAIG
AAIKCFNGAHGINVPRSRFLPVKKTADLLLAMSNLYTLRCGTLEMNPARSFPTVPLIKLG
DEFKKVRDFLRRFEDIPDILELDHLTVSGDVTFGKNVSLKGTVIIIANFGERIDIPSGAV
LENKIVTGNLRILEH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacgttgctgaatttcaagctcaagctaaacgtgattctgaaattgctatgcaa
catgacttggatgcaatgctacaaactgctcctgccgatcaaaaagaggcaagtactata
atgggcaaggaattgaatggtttcagcaagctattttcaaggtacattgaaaataaaggt
tccgcaatcaagtgggacaaaattcgaccattgccggaaggagcagtccgaaagtatgat
gatatcaaagtacgagaatccgaggtttccagagctctattagatcagctagtggtttta
aaactgaatggtggattaggaactagcatgggttgcactggacctaaaagtatcattact
gtccatactaatgcaacatttctggatcttaccattcaacagattgagttcttgaacgac
aagtacaatgcaagcgttccgttggtactcatgaattcgttcaatactcacgaagatacg
ctgaaagtactacgaaaatacaaatccgctcgggttgatattcattgcttcaatcagagc
cgatatcctcgcatttacagtgacaacctgcatcctgttgctagtcaatttgatgatcat
catgattgttggtacccacccggtcatggtgatacttatgctgctttctctaattctgga
ctgttggagaaatttttagccatgggcaaacgctatgttttcatttccaatattgataac
ctaggagcagttgttgatatgtctattttaaactacttagccagccctactgatggtgaa
cgatgtgactttgttatggaagttactgataaaactagatctgatgttaagggtggtacg
ctcatcagttatgaagataaattgcgtcttttggaaattgctcaagtccctaaagatcat
gtcgacgaattcaaatccatcaagaaattccagatttttaacactaataatatttggatt
gacatgaaagcaattcatgagttgtacagcagcaacgccctagacatggaaattattgtg
aataacaaaacaatggataccaccggtgcacatgtcatacagctggaaaccgctattgga
gcagccatcaaatgctttaatggcgcccatggcattaatgtaccgcgttcccgctttctg
ccagttaagaaaacggctgatcttttgctagccatgtcgaatctatatactctgaggtgc
ggtaccttggaaatgaatcctgctcgttcctttccaactgttcccctaattaaacttggc
gatgaattcaaaaaggtcagagatttcttgagacgttttgaagatattccagatattcta
gagctagatcatctcactgtatccggagatgtaacatttggaaaaaatgtatctcttaag
ggcacagttataataatagctaactttggcgagaggattgacattcctagtggcgctgtc
ttggaaaacaaaatcgtgactggaaatttgcgcattttagaacattag

DBGET integrated database retrieval system