KEGG   Trichoplax adhaerens: TRIADDRAFT_37648Help
Entry
TRIADDRAFT_37648  CDS       T01069                                 

Definition
(RefSeq) expressed hypothetical protein
  KO
K00522  ferritin heavy chain [EC:1.16.3.2]
Organism
tad  Trichoplax adhaerens
Brite
KEGG Orthology (KO) [BR:tad00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tad04147]
    TRIADDRAFT_37648
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.2  bacterial non-heme ferritin
     TRIADDRAFT_37648
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRIADDRAFT_37648
  Exosomal proteins of bladder cancer cells
   TRIADDRAFT_37648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ferritin Rubrerythrin DUF2336
Motif
Other DBs
NCBI-GeneID: 6752893
NCBI-ProteinID: XP_002112176
JGI: 37648
UniProt: B3RTK1
AA seq 172 aa AA seqDB search
MASNARQNYHEDCEAGVNKQINLELYASYVYLSMAYYFDRDDVSLPNFHKYFKKASYEER
EHAEKLLELQNTRGGRIVLQDIKRPERDEWGSCSDAMSAALALEKYVNQALLDLHSVAER
HNDSQLCDFLEGNYLQEQVTAIKEIADYVAQLKRVGQGLGEYQFDRLTLGSQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaatgcaaggcaaaattatcacgaagattgtgaagctggtgtaaacaagcaa
attaacttggaattatacgcaagttatgtctatctctccatggcgtactacttcgaccgt
gacgatgtgagcctgcccaactttcacaaatacttcaagaaagcctcgtatgaggagaga
gaacatgccgagaaattgcttgaactacaaaatacccgtggtggacgtatagtcttgcaa
gatatcaagagacctgaacgtgacgaatggggttcatgctcggatgccatgtctgctgct
ctcgccttagagaaatacgtcaaccaggctttacttgatttacatagtgttgctgagcgc
cataatgattcacagttatgtgactttttggaaggaaactatctacaagaacaagtcaca
gccatcaaggaaatagctgattatgttgcacagcttaaacgtgtcgggcaaggtcttggt
gaataccagttcgacaggttaacattagggtcacaataa

DBGET integrated database retrieval system