KEGG   Trichoplax adhaerens: TRIADDRAFT_38152
Entry
TRIADDRAFT_38152  CDS       T01069                                 

Definition
(RefSeq) arp2/3 complex 20 kd subunit
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
tad  Trichoplax adhaerens
Pathway
tad04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tad00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    TRIADDRAFT_38152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tad04131]
    TRIADDRAFT_38152
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tad04812]
    TRIADDRAFT_38152
Membrane trafficking [BR:tad04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    TRIADDRAFT_38152
Cytoskeleton proteins [BR:tad04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     TRIADDRAFT_38152
SSDB
Motif
Pfam: ARPC4 TarS_C1 HTH_Tnp_Tc3_1
Other DBs
NCBI-GeneID: 6756922
NCBI-ProteinID: XP_002115845
JGI: 38152
UniProt: B3S651
AA seq 149 aa
MCLQNFSSQVIERHNKPEVEVGSSKELLLTPIIISRNEKERVLIESSINSIRVSIAVKQA
DEIEKILCHKFMRFMMLRAENFIILRRTPMQDYDISFLITNFHTEMMLKHKLVDFVIHFM
EDIDKEISEMKLAVNARARICAEEFLKTF
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtgtcttcagaacttttcctctcaagttattgaacggcacaacaaacctgaagttgag
gtcggaagcagtaaggagttgctcttaacaccgattattatcagccgtaatgaaaaggaa
agagtgctgattgaaagctctatcaattccatccgtgttagtattgcggttaaacaggcc
gacgaaattgagaagatactatgccacaagtttatgcgtttcatgatgctgcgtgctgag
aatttcattattttaagacgaacaccaatgcaggactatgacattagctttttaattacc
aactttcacacggaaatgatgctgaaacataaattagttgatttcgtgattcacttcatg
gaagatattgataaggaaataagcgaaatgaagcttgcagtcaacgcacgcgctcgtata
tgcgcggaagaatttcttaaaacgttttag

DBGET integrated database retrieval system