KEGG   Trichoplax adhaerens: TRIADDRAFT_38294Help
Entry
TRIADDRAFT_38294  CDS       T01069                                 

Definition
(RefSeq) heat shock cognate protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tad  Trichoplax adhaerens
Pathway
tad03040  Spliceosome
tad04141  Protein processing in endoplasmic reticulum
tad04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tad00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TRIADDRAFT_38294
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TRIADDRAFT_38294
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    TRIADDRAFT_38294
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tad01009]
    TRIADDRAFT_38294
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tad03041]
    TRIADDRAFT_38294
   03009 Ribosome biogenesis [BR:tad03009]
    TRIADDRAFT_38294
   03110 Chaperones and folding catalysts [BR:tad03110]
    TRIADDRAFT_38294
   04131 Membrane trafficking [BR:tad04131]
    TRIADDRAFT_38294
   03051 Proteasome [BR:tad03051]
    TRIADDRAFT_38294
   03029 Mitochondrial biogenesis [BR:tad03029]
    TRIADDRAFT_38294
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tad04147]
    TRIADDRAFT_38294
Protein phosphatases and associated proteins [BR:tad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TRIADDRAFT_38294
Spliceosome [BR:tad03041]
 Complex B
  Other components
   Prp19 complex
    TRIADDRAFT_38294
 Complex C
   Prp19-CDC5 complex
    TRIADDRAFT_38294
Ribosome biogenesis [BR:tad03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    TRIADDRAFT_38294
Chaperones and folding catalysts [BR:tad03110]
 Heat shock proteins
  HSP70 / DNAK
   TRIADDRAFT_38294
Membrane trafficking [BR:tad04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    TRIADDRAFT_38294
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    TRIADDRAFT_38294
Proteasome [BR:tad03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    TRIADDRAFT_38294
Mitochondrial biogenesis [BR:tad03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    TRIADDRAFT_38294
Exosome [BR:tad04147]
 Exosomal proteins
  Proteins found in most exosomes
   TRIADDRAFT_38294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 6757769
NCBI-ProteinID: XP_002116623
JGI: 38294
UniProt: B3S8M5
AA seq 659 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFNDSERLIGDAAKNQVA
MNPTNTVFDAKRLIGRKFKDGPVQSDMKLWPFNVIDEGTRPKISVEYKGETKTFYPEEIS
SMVLNKMKDTAEAYLGKSVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAA
IAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNNMVNF
FMGEFKRKYKKDISGNKRSVRRLRTACERAKRTLSSVTQASIEIDSLFEGIDFYTSITRA
RFEELNGDLFRSTTQPVEKAIRDAKMDKSSIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSEDVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTI
PTKQTQTFTTYADNQPGVLIQVYEGERAMTKDNNSLGKFELSGIPPAPRGVPQIEVTFDI
DANGILNVSAVEKSTGKENKITITNDKGRLSKDDIERMVNEAEQYKAEDDKQRDKISSKN
SLESYAYNMKSTVEDDKVKDKISDDDKKVILDKCTEALDWLDKNQTAEKDEFEYQQKELE
KVCAPIITKLYQAAGGAPGGMPGGMPGGMPGGMPGGMPGGGAPPSGGSGSGGPTIEEVD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaggtccagcggttgggattgatttgggtacgacgtattcctgtgttggaatc
tttcagcatggaaaagtcgaaattatcgcaaatgatcaaggtaacagaacaacaccaagc
tatgtagctttcaatgactctgagcgtctcattggtgatgccgccaaaaatcaagtagca
atgaaccctacaaatactgtctttgatgccaaacgtttaattggacgtaaatttaaagat
ggccctgtccaatccgacatgaagctgtggcccttcaatgtcattgatgagggcactcga
ccaaaaatttctgttgaatataaaggtgaaacgaaaactttttacccggaggaaatatcc
tccatggtattgaataaaatgaaagatactgctgaagcgtatctcggtaaaagcgtcact
gatgctgttgttacggtacctgcctactttaacgattctcaacgacaagctactaaagat
gctggcaccatcgctggtttgaatgttatgcgtattattaatgaacctacagcagctgct
attgcctacggtttagataagaaagttggaggagaacgaaacgttcttatcttcgatctt
ggtggtggcacttttgatgtatccattttaacaattgaagatggtatctttgaggtaaaa
tcgacagctggagacactcatcttggtggtgaagattttgataataatatggtcaacttc
tttatgggcgaatttaaacgcaagtataagaaggatataagcggaaacaagcgctctgtc
cgtcgtctaagaacagcttgtgaaagagcaaagagaacattgtcttcagtcactcaagcc
agtattgaaattgattcgctatttgagggtatcgatttctacactagtattacaagagct
cgttttgaagaattaaatggcgatcttttccgaagcactacgcaacctgtagagaaggcg
atacgcgatgctaaaatggataaatcatcaatccatgatatcgttcttgtaggtggttct
acacgtatccccaagatccaaaagttgttgcaagatttctttaacggcaaagaactaaat
aaatccatcaatcctgatgaagccgttgcatacggcgctgcagttcaagcggctatatta
agtggtgacaagagtgaagatgtccaagatctgttattacttgatgttgctcccttgtca
ctcggtatcgaaacggccggtggcgtgatgacggctttaattaagcgtaatactactatt
cctaccaagcagactcaaacttttaccacttacgctgataatcagccaggtgtcttgatt
caggtgtatgaaggggaacgtgcaatgacaaaggataataattcactcggaaaattcgag
ttaagtggcatccctccagctccacgaggtgtacctcaaattgaagttacattcgacatt
gatgcaaatggtatattgaacgtttcagctgttgaaaagagtacaggtaaagaaaacaaa
atcacgattactaacgataaaggccgattatctaaagacgatatcgaacgcatggtgaac
gaagcggaacaatacaaagctgaggatgataaacaacgcgataaaatttcttcaaagaat
agtttggagagctatgcttacaatatgaagagcacagttgaagacgataaagttaaagat
aaaattagtgacgatgacaagaaagtcattttggataaatgcacggaagctttggattgg
ttggataagaatcaaactgccgaaaaagacgaatttgaatatcaacagaaagagcttgaa
aaagtttgtgcgcctatcattacaaaactgtatcaagctgctggtggtgcgcccggtggt
atgcctggtggtatgcctggtggtatgcctggtggtatgcccggtggtatgcccggcggt
ggtgctccaccaagcggtggctctggtagtgggggtccaacaattgaagaagtagattaa

DBGET integrated database retrieval system