KEGG   Trichoplax adhaerens: TRIADDRAFT_38509Help
Entry
TRIADDRAFT_38509  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tad  Trichoplax adhaerens
Pathway
tad00010  Glycolysis / Gluconeogenesis
tad00051  Fructose and mannose metabolism
tad00562  Inositol phosphate metabolism
tad01100  Metabolic pathways
tad01200  Carbon metabolism
tad01230  Biosynthesis of amino acids
Module
tad_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tad_M00002  Glycolysis, core module involving three-carbon compounds
tad_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRIADDRAFT_38509
   00051 Fructose and mannose metabolism
    TRIADDRAFT_38509
   00562 Inositol phosphate metabolism
    TRIADDRAFT_38509
Enzymes [BR:tad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TRIADDRAFT_38509
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TRIADDRAFT_38509
  Exosomal proteins of bladder cancer cells
   TRIADDRAFT_38509
  Exosomal proteins of melanoma cells
   TRIADDRAFT_38509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 6759169
NCBI-ProteinID: XP_002117956
JGI: 38509
UniProt: B3SCI7
AA seq 248 aa AA seqDB search
MADRKFIVGGNWKMNGSRESIDGIIQFLKQGPLNESTEVVVGPPFVYLSYVKENLPDKVS
IAAQNCYYASKGAFTGEISAEMAVDIGCEWVILGHSERRNVFGETDEIIGKKVAHALTSG
LKVIACIGELLSEREEGRTFDVLSRQIKAIADNISDWSKVVIAYEPVWAIGTGKTATPQQ
AQQVHLQLRNWLKEHISDSVAASCRIMYGGSVNAGNCKDLAVQPDVDGFLVGGASLKPDF
VQIVNARM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcgaaagtttattgttggtggcaactggaaaatgaatggcagtagggaaagc
atcgatggaattattcagttcttaaagcaaggaccgcttaacgaatcgactgaagttgta
gtcgggccacctttcgtttacctttcttatgttaaagaaaacttacctgataaagtctcg
attgcggcccagaattgctattatgcctcaaaaggagcatttacaggagaaattagtgcc
gaaatggctgttgatatcggttgtgagtgggttattctcggccattcagaaagaagaaat
gtgtttggtgaaactgatgagattataggcaaaaaagttgctcatgctttgaccagtggg
ttaaaggttatagcttgcattggggagttgcttagtgagcgcgaggaaggaaggactttt
gatgtcttatccagacaaattaaggcaatcgctgataatatctctgattggtcaaaggtt
gtaatagcttatgaacctgtctgggctattggaactggaaaaacggcaacaccacagcag
gctcagcaagtccacttacaattgcgcaattggctaaaggagcatatttctgattcagtg
gcagccagctgtaggattatgtatggaggttcagttaatgctggaaactgcaaagaccta
gcggttcagccagatgtggatggatttctagttggtggtgcatctttaaagcctgatttt
gtgcaaattgtaaatgctcgtatgtaa

DBGET integrated database retrieval system