KEGG   Trichoplax adhaerens: TRIADDRAFT_50528Help
Entry
TRIADDRAFT_50528  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TRIADDRAFT_50528
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TRIADDRAFT_50528
Chromosome and associated proteins [BR:tad03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    TRIADDRAFT_50528
   HAT complexes
    Elongator complex
     TRIADDRAFT_50528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 6755341
NCBI-ProteinID: XP_002114444
JGI: 50528
UniProt: B3S1C1
AA seq 515 aa AA seqDB search
MVLTIQDIIKQLIQAHDEGRDVNLNKIKSITSSKYGLPSQPRLVDIVAGVPRNYRKVLVP
KLKAKPVRTASGIAVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTS
MRAIRARYNPYLQVKHRTEQLRQLGHNVDKVEFIVMGGTFMALDEEYRDYFIRNLHDALS
GHTSNNVEEAVKYSEHSKTKCIGITIETRPDYCLKKHLSSMLNYGCTRLEIGVQSVYEDV
ARDTNRGHTVRAVCESFQQAKDAGFKVVAHMMPDLPNVDIERDIQGFTEFFENPAFRADG
LKIYPTLVIRGTGLYELWKTGRYRSYPPDVLIDLVARILALVPPWTRVYRVQRDIPMPLV
SSGVEHGNLRELALARMKDLGTECRDVRTREVGIQELHQKVKPYEVELIRRDYYANGGWE
TFLSYEDTFRSELKGGCSIVRELHLYGSVVPVSARDPTKFQHQGFGMLLMEEAERIALEE
HGSNKMSVISGVGTRNYYRKLGYELDGPYMSKSLR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtcttaacaatacaagatataatcaaacaattaattcaagctcatgacgaaggtcga
gatgttaacctcaataaaattaaaagtataacttcaagtaaatatggactaccatctcaa
ccacgtttggtagatatcgtagctggtgtaccacgaaattatagaaaggttcttgttccg
aaattgaaagcaaagcctgtccgaactgcatctggaatagctgttgtagctgtaatgtgc
aagcctcatcgctgtcctcacatttcaatgactggtaacatttgtgtttattgccctggt
ggacccgattctgactttgaatactcaactcagtcttatactggttatgagccaacttcc
atgagagcaattagagcacggtataatccttacttgcaagttaaacatcgaacagaacag
ttacggcagcttggtcacaatgtcgataaggttgaattcatagtgatgggtggaacattt
atggctttggatgaagaatatcgggattactttattcgcaacttacacgacgctctttct
ggtcatacaagtaataatgtagaagaagcagtaaaatactcggaacatagtaaaacaaaa
tgtatcggtattactatcgagacccgccctgattactgcctaaagaagcacttaagttct
atgctcaattatggatgtaccagattagaaattggagttcaaagcgtatatgaagacgtg
gcaagggacacaaatagagggcataccgtcagggcagtctgtgaatcttttcaacaagct
aaagacgctggttttaaggttgttgctcatatgatgccagatttgccgaatgtcgatata
gaacgtgatatacaaggtttcacggaatttttcgagaatcctgcatttcgagcagatggg
ctaaagatttatccaacactagtcataagaggaacaggactatatgaactatggaagact
ggaagatatagaagctatccccctgatgtattaatagatcttgtggctagaatcttagct
ctagtaccgccttggacgcgagtgtacagagttcaaagggatattcctatgccattagta
agctctggtgtcgagcacggaaacttgagagagttagcactagctaggatgaaagacctt
ggtactgagtgccgcgatgtacgtacgagggaagtcggaattcaagaattacatcaaaaa
gtcaagccttatgaggtggaactcattcgtcgtgattactacgccaacggaggctgggaa
actttcttatcttacgaagataccttcaggagtgaactgaaagggggatgttctatagtt
agagaactacatttatatggaagtgtagtgcctgtcagtgcacgggacccaacgaaattt
caacaccaaggttttggaatgctactaatggaggaagcagaacggatagcattggaggaa
cacggatccaataaaatgtctgttatatctggagttggcactagaaattattatagaaaa
cttggctacgaattagatggtccatacatgtcaaaaagcctaagatag

DBGET integrated database retrieval system