KEGG   Trichoplax adhaerens: TRIADDRAFT_50647Help
Entry
TRIADDRAFT_50647  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K16794  platelet-activating factor acetylhydrolase IB subunit alpha
Organism
tad  Trichoplax adhaerens
Pathway
tad00565  Ether lipid metabolism
tad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    TRIADDRAFT_50647
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tad03036]
    TRIADDRAFT_50647
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tad04147]
    TRIADDRAFT_50647
Chromosome and associated proteins [BR:tad03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    TRIADDRAFT_50647
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRIADDRAFT_50647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 LisH Nucleoporin_N DIPSY LisH_2
Motif
Other DBs
NCBI-GeneID: 6756231
NCBI-ProteinID: XP_002115182
JGI: 50647
UniProt: B3S4I5
AA seq 409 aa AA seqDB search
MVLSPKQEEELRFAVADYLQSCGYTNALEAFKKDASIPKEIDNKKYSGLLEKKWTSVVRL
QKKVMDLELRLNNTTREMNSGVPTRNSRSSNDWIPRPPEKHSLSGHRSPITCVVFHPVYN
VMVSSSEDASMKIWDYESGDFERTLRGHTDSVQDLAFDSSGKLLASSSADMTVKIWDFQT
FECRMTLRGHDHNVSSVCFLPSGDFLLSSSRDKTIKMWEVATGYCVYNFEGHREWVRRVA
VASDGSLMASCSNDQTVRIWSLSSKECKEELRGHEHVVECIKWAPESCNRYINEASGTEV
PKGQKSGPFLASGSRDRVIKIWDVTTAVCLFSLVGHDNWVRGLAFHAGGKYLTSASDDKT
IKIWELRHKRCSKSLEAHNHFVTTIDFHRSSPFVITGSVDLTIKVWECR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggtactatcaccaaagcaagaagaagaactgcgtttcgctgtcgctgattaccttcaa
tcatgtggatatactaacgccctggaagcctttaaaaaagatgcatcaattcccaaggaa
attgataacaaaaagtacagcggcttattagagaaaaaatggacctcagtagtaagattg
cagaagaaagttatggatcttgaattaaggcttaataatacaacaagagaaatgaacagc
ggagttccaacaagaaattctcgttcctcaaacgactggatccccagaccaccggaaaaa
catagtctttctggtcatcgaagtcctattacctgtgttgtgttccacccagtatataac
gttatggtttcttcatcagaagacgcctcgatgaagatctgggattatgaatctggcgat
tttgaaagaacattgagaggacatactgattcagttcaagatttggcctttgattctagt
ggtaaattactcgcatcttcctctgctgatatgactgtcaaaatatgggattttcaaact
tttgaatgcagaatgacacttcgtggtcacgatcataatgtttcatcggtatgctttctc
ccgtccggcgactttttattatcttcctcaagagacaaaactattaaaatgtgggaagtt
gcaactgggtactgtgtttataatttcgaaggtcatagggaatgggtgagacgagttgct
gttgcatctgacggatctctaatggcaagttgttccaacgatcagactgttcgcatttgg
tcactatccagtaaagaatgcaaagaagaattgagaggtcatgaacatgtagttgaatgt
attaagtgggctccagaaagttgcaataggtatattaatgaggccagtggtacagaagtg
ccgaagggacaaaagtctggcccatttttagcttctggttctcgagatcgtgtaattaaa
atatgggatgtcactactgcagtttgcctattttcattggtgggccatgataattgggtt
agaggtttagcatttcatgctggtggtaaataccttactagcgcttcggacgataagact
atcaaaatttgggaattaagacataaaagatgttcaaaaagtctagaggctcataatcat
tttgttactacaatagattttcatcgttcgtcaccgttcgttatcacaggtagtgttgat
ttaacgattaaagtttgggaatgtcgctag

DBGET integrated database retrieval system