KEGG   Trichoplax adhaerens: TRIADDRAFT_51673Help
Entry
TRIADDRAFT_51673  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
tad  Trichoplax adhaerens
Brite
KEGG Orthology (KO) [BR:tad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tad03036]
    TRIADDRAFT_51673
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     TRIADDRAFT_51673
Chromosome and associated proteins [BR:tad03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    TRIADDRAFT_51673
   microRNA pathway
    RISC loading complex
     TRIADDRAFT_51673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuclease_3 PAZ Helicase_C ResIII DEAD Dicer_dimer Ribonucleas_3_3 SWI2_SNF2 AAA_22
Motif
Other DBs
NCBI-GeneID: 6749013
NCBI-ProteinID: XP_002107798
JGI: 51673
UniProt: B3RKG6
AA seq 1418 aa AA seqDB search
MAIDDRLLNGVQYYHRADKQTWSCHYLALSSAKVCTSVTQLIFQELNTSRMKLSPRKYQL
DLAVIAQERNTIVYLETGSGKTLIAVLVIRQLYRELSKSLQAGGKRAIFLVNTVPLVHQQ
AKFIADQTSFCVGKLFGKCNSDKRRSNWKDFFDKNNVIVGTPQTLLRLLELNIVNMQMIN
LIVFDECHHATKHHPYSRIMDAVKALEEQGRPKILGLTACIFKGECKPSKVPQRLAELEE
KLSSTIAIPGYLTYIDKNKTPPTEYVIDYETTETSIFEQVEALSDCSFLLKGFDAMYSNS
FESKAQREQQSTSLQLVLTAFDEAILTVNTFGLRIFPLVAESIVKCIRKELRMFRGKDGI
DYKLSASNSWFRPVIRILEAKLSTKIDESHPCYTCSHFAKLLDVLTTFKEQDTGIIFVDR
RVTAFVLHELLVRISHTDPNLAHLNVGCVIGRSSIKSQLLGQAQMSRYEQEEVMNRFRRH
KYNLLVATNVLEEGVDVSECNVVIRFDRVNHFSSYLQSRGRARADDSSYVLMINRENLDA
FMEEYNSWHSVEKFLRSSPELLNTIVSGISKSLFSNDNSTTDASTISSKFVVETTGAEVN
LFSAISVLLRYSQSMINGKSPEFEYETNDDRTRAKIKLIFSNPPEKTTIEGPMMQSKKIA
KKASALEACKFLHEVGEITDNLEPNVGKYHQSIDKSQYKQFPIKFPDNLSMPIEDGDNFY
LHMIKIELKNSTIESIDTVSCSSDFGLICKTKLHEIEPTYLQTSCGDILFSLQSLAVPMH
YSCDELSLISKFVEYLFTNITPCSTITDLIYDPTNSYAKYMIVPLNYAKSSRSMYSINFE
LMATLLKPRKYWPFASNLGDGCKNVNDLLIVKNYGHWVTNQVDVYALRNICYDLSPLSRF
PTDKRLTYKAYYHRKYHTRIENSNQPLFAVKTLHRFPVALVHENCISPCNNTTESKKSNS
GFVHLVPELCLVHPFSASMWMLSQFLPLTLYKIEKNCLAYEMIDYIQCASILKKVTEPRR
KKLLLRETTNLVDRITQSLTLPIAEEQCNFNKIKYIGKVFIKLVLAVNLYQTCPDDNSYA
LTMKRRQQSSEFYLFNLAAKTNIPSYIISKPFNQLKCWIPPGFTFSIRCKDDSSSDSALA
ERTIIESITDNFLSVKSIAECISAIVGALLFPDNETEGLNFLKWLGFAIEPFSSISNGFD
VWNEKITHMIEESNSQSWLEKLHKFEENLGYKFINIDYLILAFTHSSSEFGDSFNYEKLE
FVGDSILNYLVIKYLFLATDQDITRSKFFYGIAISNEVYGLLSYAYNFHHLFYQSPFVKE
MILGFEKKTADLLEGGSIPRNGNKHDWVYTIFSKSIDDDFSIPKELADVFESLAAAIYFD
SGQNLSTVWNIYSNLLKPFLDKLLKDNQKNFQELNGED
NT seq 4257 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgatgatagattattgaatggtgtacagtattatcatcgtgcagacaagcag
acgtggtcttgccactatctggctctgagttctgctaaggtctgcacgtctgtaacgcaa
ctcatctttcaagaattgaatacgagcaggatgaaattatcaccgcgaaaatatcaacta
gatcttgctgtgatcgcgcaagaaagaaatacaatagtctatttagaaacgggtagtggg
aaaaccttgattgctgtccttgtcattcgacaattgtacagggagctatccaagagccta
caagcaggaggcaagagagctattttcctagttaacacagtccctcttgttcaccagcaa
gccaaatttattgccgatcaaactagtttctgcgttggtaaactatttggtaaatgtaat
agtgataaacgtcgttccaattggaaagattttttcgataaaaacaacgttatagttggc
acaccgcaaacgttattaagacttttagaattgaatattgtcaacatgcagatgatcaat
ttgatagtatttgatgaatgccatcatgccaccaaacatcatccgtatagccgtatcatg
gatgccgtaaaagcactcgaagaacagggcagacctaaaattcttggtttgactgcatgt
atatttaaaggagaatgtaaaccgagcaaagtgccccaaaggttagcagaactagaggaa
aaattatcaagtactatcgctattccgggttacttaacttacatcgataaaaacaagaca
cctccaacagaatatgtaatcgattacgaaaccacagaaacctctatttttgaacaagta
gaagcgctgtcagattgttctttcctcttgaaaggattcgatgcaatgtattccaattct
tttgagagtaaagcgcaacgtgaacagcaatctacttcattgcaacttgtgttgacagca
tttgacgaagctattctcacagtcaacacttttggtttacgtatatttcctttggtcgcc
gaaagtatcgtgaaatgtatcagaaaggaattaaggatgtttaggggaaaggatggaatc
gattacaaactttccgctagtaattcttggtttcggcctgttatacgaatattagaagcc
aaacttagcactaagattgatgaatcccacccttgttatacgtgttctcattttgccaag
ttattggatgtattgaccaccttcaaagagcaagatactggtatcatctttgtcgataga
agagttaccgccttcgttttacatgaattactcgtgcgaatttcacatacggatcccaat
ttagcccatttaaatgttggttgtgtcattggccgtagtagtatcaagagccaactttta
ggacaagcgcaaatgagtcgatatgagcaagaagaagtgatgaaccgattccgaaggcat
aaatataatttattagttgctacaaatgtgctggaagaaggtgtcgatgtatctgagtgc
aatgtagttataagatttgatcgcgtcaatcattttagttcatatttacagtctagaggg
agagcgcgtgctgacgactcttcctatgtactgatgatcaatcgagaaaaccttgatgca
ttcatggaagaatataactcgtggcattcggtagaaaaattcctacgtagctcaccagaa
ttgctgaatactatcgtttctggcataagcaagtcccttttctcaaatgataatagtacg
actgatgcaagcacaatcagcagcaaatttgtcgttgaaactaccggtgccgaagttaac
ctgttttcagctatcagtgtattgctcaggtacagtcaaagcatgatcaatggtaaatct
cctgaatttgagtacgagacgaatgatgatcggactcgagctaaaataaagttgatattt
tctaatccgcccgaaaaaactaccatagagggtccaatgatgcaaagtaaaaaaattgca
aaaaaagcctccgccttagaagcatgtaaattccttcatgaagttggtgaaattaccgat
aacttggaaccgaatgtgggaaagtatcatcagtctattgataaaagccagtataagcaa
tttccgattaagttccccgacaatttatcgatgccaatcgaggatggtgataacttctat
cttcacatgattaagattgagctaaagaacagcacaatagagtctattgatactgtcagt
tgtagttcggacttcggattaatatgcaagactaagttacacgagattgagccaacttat
ttacaaacatcgtgtggcgacatattattttcgttacaatcactggctgtcccgatgcac
tattcatgcgatgaattaagccttatttcgaaatttgtagagtatttatttaccaatatc
acaccctgtagtacaataacggacttaatctacgatcctacaaacagttatgcaaaatac
atgattgttcctctaaattacgccaagagcagcaggtctatgtattctataaattttgaa
ttaatggcaacgctattgaagccacggaaatactggccctttgctagtaatctcggtgat
ggttgcaagaacgttaatgacctcttaatagtcaaaaattacggccactgggttacgaac
caagtcgacgtatacgctctgcgaaacatctgctacgacctctcaccgctttctcgtttt
ccgacggataagcgacttacttataaagcatattaccatcgcaaatatcacaccagaatt
gagaactcaaatcaacctttattcgctgttaagacattgcatcgattccctgtagcttta
gtgcatgaaaattgcatatccccttgtaataatactactgaaagtaagaaaagtaatagt
ggtttcgtacacttagtgcctgagttatgccttgttcatccattttccgcatcaatgtgg
atgctctcacagtttttacctctgaccttatacaaaatagagaagaattgtcttgcttat
gagatgatcgattatattcagtgcgcatccattctgaagaaagtaacggaacctcgaagg
aaaaaactattgctacgtgaaacaaccaacctcgtggatcgtatcactcagtcattaacc
ctccctattgcagaagagcaatgtaattttaataagattaaatatataggaaaagttttt
atcaaattggttctcgctgttaatttataccaaacctgccctgatgataattcctatgct
ctaaccatgaaacgacgacagcaaagtagcgaattttatctgtttaatctagctgctaag
acaaatattccatcctatattatcagcaagcctttcaatcagttaaagtgttggattccc
cctggttttacttttagcatccgttgcaaggatgatagctctagcgattcagccttggct
gaaaggacgattatagaatcgataacagacaattttttatctgttaagtcaatagcggaa
tgcatatctgcaattgttggagcactgttatttcctgataacgaaactgaaggcttaaac
tttctaaaatggcttggatttgccattgagccattttcctcaatcagcaacggttttgac
gtctggaatgaaaagattactcacatgattgaagaatctaattcccagtcgtggttagag
aaactacacaaatttgaggaaaatcttggatacaaattcattaatattgattacttaatt
ttagcctttacacattcatcaagcgaatttggagattcttttaattacgaaaaattagag
ttcgttggtgattcgattttgaattatctcgttattaaatacttgtttttggcaacagat
caagacataactagatctaaatttttttatggtattgctatatcaaatgaggtctatggt
ttattatcttatgcatataactttcaccatctattttatcagtcccctttcgtaaaggag
atgatccttggttttgagaagaaaacggccgatttacttgagggaggttctataccaaga
aatggcaataagcacgattgggtgtacactattttttcgaaatcaatcgacgacgatttc
agtattccaaaggaacttgctgacgtttttgaatctttagctgcagctatttattttgat
agtggtcaaaatctttcgaccgtatggaatatttattcaaatttattaaaaccttttcta
gacaagctgctgaaagataatcaaaaaaatttccaagaactcaacggtgaagattga

DBGET integrated database retrieval system