KEGG   Trichoplax adhaerens: TRIADDRAFT_51757Help
Entry
TRIADDRAFT_51757  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
tad  Trichoplax adhaerens
Pathway
tad00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tad00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TRIADDRAFT_51757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tad01007]
    TRIADDRAFT_51757
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tad03016]
    TRIADDRAFT_51757
Enzymes [BR:tad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     TRIADDRAFT_51757
Amino acid related enzymes [BR:tad01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TRIADDRAFT_51757
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TRIADDRAFT_51757
 Prokaryotic Type
    TRIADDRAFT_51757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e NOT2_3_5 DALR_2
Motif
Other DBs
NCBI-GeneID: 6749056
NCBI-ProteinID: XP_002107841
JGI: 51757
UniProt: B3RKT4
AA seq 764 aa AA seqDB search
MNQEAQLKLYNSMTRRKDTFVPSNESCLSWYNCGPTVYDASHMGHARSYVSFDIIRRVLT
SYFNYNISYAMNITDIDDKIIFRARRNYLIDNYISSSHPIDRIIEDANEAVKLLEDKIHV
SKYLDLLTITEKLTAQQNKINTTKDGHQLKELEKIGKKLLENKAEILKDPQQLAMAEDNE
KLATLAEKKMKLKESNIALTNDPNKLAMFVKNKIKADNAIQSLSSAAIGQSDVKSGSRLQ
EFFSDIRDPLSELLDKKVLPADAITRVSEYVPEVIEFVQGIIKRNYGYVSNGSVYFDTVA
FNNSPDHRYGKLLPEAIGDLNALAEGEDNNKSNKLDSLICGLSNLSNSDAHLIGELSIGD
DRLREKRSPNDFALWKCSKPGEPFWDSPWGKGRPGWHIECSVMASAILGKSLDIHSGGVD
LKFPHHENEIAQVEEALSKYSARQLRLAFLSHPWNTTMDYSENMMSSTMQTEKLFLEFFL
NVKDIDRVYSAQTLKEEKWNSAELELEKGLCQKQNNIHRFLCDSINTPDVMKELKELINQ
SNSYIASKRSLKQSPNARLLKKISRYIVKMLRIFGVTVDEIETTIGFPSYTDNKVCNLFL
VIYEFIGVMAININKENTIMPYLTVLAEFRAKVRDSARLQKVYKLSNGSHCIDGPAIKLV
DRAILLKEKENRLMAIEEKKRKKEEAKRKQMELKAQQESKMKISPKEMFLNQSDKYSQFD
EKGIPTHNHEGTELSGKQKKKLLKQYEAQKKLFLEYQTKQAPSN
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagaagcgcaattgaaattatataatagtatgacccgaagaaaggatacattt
gtacctagcaatgaatcttgcctatcatggtacaattgcggacctactgtctatgatgca
tctcacatgggtcatgcaagatcctatgtcagctttgacattattagacgcgtattaact
tcgtatttcaactataacatatcttatgctatgaacataaccgatattgacgataagatc
atctttcgggctcgtcgtaactatttaattgataactatatcagtagctctcatccaatt
gatagaattattgaagatgcaaacgaagcagttaagttactggaagataagatccatgta
tcgaaatatctcgatttgttaacaattacggaaaaacttacggctcagcaaaataagatt
aatactactaaggatggtcatcaattgaaagaattagagaaaatcggaaaaaagctttta
gagaataaagctgaaattttgaaagatccacagcaacttgccatggcagaagataacgaa
aaattggctactctggctgagaagaaaatgaaattgaaggagagtaacattgctctaact
aatgatccaaacaagcttgcaatgtttgtgaaaaacaagattaaagcggataacgctatt
caatcacttagtagcgctgccatcggccaaagtgacgtaaagtctggcagtcgtctacag
gaattcttttcagatataagggatcctttatcagagctattagataaaaaggttcttcct
gctgatgctataacgcgagtaagtgagtatgtaccggaagttattgaatttgtacaagga
attatcaaaagaaattatgggtatgtatcgaatggctctgtatactttgacaccgtagcc
ttcaataatagcccggatcatcgttatggaaagttattacctgaggctattggagattta
aatgctttagctgaaggagaagataataataagtcgaacaagctcgatagtttgatatgt
ggtctaagcaatttatcaaattcggatgcacatttaataggtgaactaagcatcggggat
gatcggttacgcgaaaaaaggagtccgaatgattttgctttgtggaaatgctctaagccc
ggtgaacctttttgggactcaccttggggaaaggggagacctggatggcacattgaatgc
tccgttatggcaagcgcaatattaggcaagtctctggatattcattctggtggcgtagac
ctaaagtttcctcatcatgaaaatgaaatagctcaagtcgaggaagccctaagtaaatac
tcagctcgtcaattgcgattggcattcttgtctcatccttggaatactaccatggattac
agtgaaaatatgatgtcttctactatgcaaacagaaaaactatttctggaattcttttta
aatgttaaagatattgaccgcgtttattcagctcaaacccttaaagaagagaaatggaac
tctgctgaattagaacttgaaaaaggattgtgccaaaaacagaataacatccatcgattt
ctgtgtgattcaattaatacacccgacgttatgaaggaattgaaggagctgatcaatcaa
tctaatagttatattgcctcaaaacgttctctaaaacaatcgcctaacgcccgtcttttg
aagaaaatttcaagatacatcgtaaaaatgttacgcatattcggtgtcacggtggatgag
attgaaacgacaatcggatttcctagttatactgataataaagtatgcaatttattctta
gtaatttacgaatttattggtgtgatggccataaatatcaacaaagaaaataccattatg
ccatatttgactgtattggctgagttcagagcaaaagttcgagatagtgctcgcttacag
aaagtttataagttatcaaatggatctcattgtatagatggtcccgcaatcaagttggta
gatagggcaattcttttaaaagagaaagaaaatagattaatggcaattgaagaaaagaaa
cgtaaaaaagaagaagcaaagagaaaacaaatggaactgaaggcacagcaagaatctaaa
atgaaaatttcgcctaaagaaatgtttttaaatcagtcggataaatattcccagtttgac
gaaaagggtattccaactcataatcacgaaggaactgaacttagtggtaaacagaagaag
aaacttctcaagcagtatgaagcacaaaagaaattatttttagaataccaaactaaacaa
gctccttcaaattaa

DBGET integrated database retrieval system