KEGG   Trichoplax adhaerens: TRIADDRAFT_52729Help
Entry
TRIADDRAFT_52729  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K14289  exportin-5
Organism
tad  Trichoplax adhaerens
Pathway
tad03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tad00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    TRIADDRAFT_52729
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tad03016]
    TRIADDRAFT_52729
   03036 Chromosome and associated proteins [BR:tad03036]
    TRIADDRAFT_52729
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    TRIADDRAFT_52729
Chromosome and associated proteins [BR:tad03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     TRIADDRAFT_52729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N Pox_A6
Motif
Other DBs
NCBI-GeneID: 6750286
NCBI-ProteinID: XP_002108349
JGI: 52729
UniProt: B3RJZ4
AA seq 911 aa AA seqDB search
MDPMMLTPEIEGEVQQLAMVVGEVLNPATSQQRRHELYMICEDIKEKSTNCPRLGLALSQ
QNYPSLTRHFGLQLLTHCVRFRWQNKISNDEKAGIKNRSIELIQEIKPGVMEEIYIVDSI
SRLLVELMKREWPQHWPDLMNRLLDLCNMGPSQVEVTLLILLRLAEDIIIGQDTALLHQS
CTVMKQALWPHLFSIFGLFSATLNECIKSVNTQATNENLKIAASECLLQVTGRKSESENC
QYQPSTNLKKYLNIILALTNHPCQTVSAIAQPLWISFMSSEHIRKNDVLREIIPGVLSNI
HCRLIKVNDLNSAQIPGIEYLRMEFSCNRDYYSFMSQYKSSEITIIKLATKLLPEAAFKK
GIEWLDSIIYQSNEDDGSHSYTVDSTLYIQWEAVACYLEKMIGILFVADSSTKPSIAMCN
EMISVLLRCKIKIFDVASRSFEAQEKQAARNENWVAVRRKATGLLVKLSKQYPQFLLPLY
DDLVTAIKPLLNRELSILRVTDYCNLIESLLLLSNIFYNFDRHCFLIHDLLTSVRTVWLS
TEIRTGFSTPSAFLNYIGFDSPDTTHVQTECLKNRLKINYCLSIILTTLKAVEIPSPMTS
EAATQYIHGNFEDGSPRYRLPHAESIYPLLDNIMVLTRLLNSLYDDNVQKKSQSFNLSYI
DLRLCEKIQLLGIHSPPLDNEELLPIDPKLINSKSAAQNFFFRIYENCIIHVSEQEDQVE
IDNPLNEEILKNNLLHSASKEFAEFLGMCLTCNGSNSTTGESEGKAELSKDTNNLGQLGL
LMLQDKGLQIHGSNNNARQSLIHLSARLYELGRNRYPSLKNLLLKIPGNSVESIEHFDTI
LPTISERKKKDKIFKELVNNVIGKDISDLFKREFISTEYMLPPQQRKTKKVDSGDVLDSD
SSNNILLSLFS
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggatccaatgatgttgactcctgaaattgaaggagaagttcaacaacttgcaatggta
gtgggagaagtccttaatccagctactagtcaacagcgacgacatgaattgtatatgatt
tgtgaagatattaaggagaagtctacgaattgtccaagattaggtttggcacttagccag
caaaattatccatctctcactcgtcactttggattacaattgctaacacattgtgtcaga
ttccgctggcaaaataaaatcagtaatgatgaaaaggccgggattaagaatcgatcaata
gagttaatacaggaaattaagccaggtgtaatggaagagatttacattgtggacagtata
agccgattgttggtcgagctgatgaaaagagagtggcctcaacattggccggacttgatg
aatcgacttctagatttatgtaatatggggcctagtcaggtagaagttacgctattaata
ttattaagattggcggaagatattataattggccaggatactgctttattgcatcaaagc
tgtacagtaatgaaacaagcgttatggccacatttgttctctatattcggtttattttct
gcaacattaaatgaatgcattaaatcagtaaatacgcaggcaacaaatgaaaatcttaaa
attgcagcttctgagtgcttattacaagtaactgggagaaaaagcgaatcggaaaattgt
caatatcagccatccactaatcttaagaagtacctgaatattattttagctttgacaaat
catccttgtcaaactgtctcagcaattgcccaacctttatggatatcatttatgagctct
gaacatataagaaagaatgatgtacttcgtgagattattcctggcgttttatccaatata
cattgccgacttataaaagtgaatgatttaaactctgcacaaattcctggaattgaatac
ttgcgtatggaattctcatgcaaccgagattactattcttttatgtctcagtataaatca
tctgaaattacgatcatcaaactggccactaagctacttccagaggctgcgttcaagaaa
ggaatagaatggctagatagcattatttatcagtcaaatgaagatgatggaagccattct
tacaccgtcgactctacgctatatattcagtgggaagctgtcgcatgctatttagaaaag
atgatagggattctttttgtcgcggatagcagtacgaagccttcaatagctatgtgtaac
gaaatgatttcggtattgctaaggtgtaaaataaagatatttgacgttgctagcagatcc
tttgaagcccaagaaaaacaagcggctagaaatgaaaattgggttgctgttcgcagaaaa
gctacgggacttctagtaaaattatcgaaacaatatcctcaattcttattgccgttatat
gatgatttagtaaccgcaattaaacccttactaaatcgggagctgtcaatactacgagtt
actgactattgtaatttgatcgaatcattattattactgagtaatattttttacaatttc
gaccgccactgtttcctaatccacgatttactaacttctgttcgaactgtttggttgtct
actgaaattagaactggtttttcaacgccgagtgcttttttgaattacattggcttcgat
tcaccagatacaactcacgttcaaacagagtgtttaaaaaatcgtttgaagattaattat
tgtttgagtatcattttaacaactttgaaagccgttgagataccatctccaatgacttct
gaagctgctactcaatacattcatggcaattttgaagatggttcaccaagataccgttta
ccgcatgcggaatcgatttatccgcttctggataacattatggttttgacaaggttgtta
aattcattatacgatgataacgtacaaaagaaatcccagtcctttaatttatcctatatc
gatcttcggctttgtgagaaaattcagttattaggtatccattctccaccgctagacaac
gaagagttgctcccgattgatccaaaattaatcaattccaaaagtgcagcgcaaaatttt
ttttttcgaatatatgaaaattgtattatacatgttagcgaacaagaagatcaagttgaa
attgacaatcctctaaatgaagagatccttaaaaataatttacttcatagtgctagcaag
gaatttgcagaatttttaggaatgtgcttaacttgcaacggaagcaattcaacaactggt
gaaagtgaaggaaaagctgagctatcaaaagataccaataatcttgggcaactgggctta
cttatgctgcaagataagggattacaaattcatgggtctaataataacgcgaggcaatcg
cttatccacttgagcgctagattatacgaactagggagaaataggtatccatcattgaaa
aatttacttttaaagatacctggaaactccgtagagagtattgagcattttgatacgata
ttgccaactatatcggaaagaaagaagaaggataaaatcttcaaggaactggttaataat
gttatcgggaaagatatcagcgatctatttaagcgagaatttatttcgactgaatacatg
ctaccaccacagcaacgaaagactaaaaaagtggatagcggtgacgtcttggattcagat
agttctaataatattttactcagcctattttcttag

DBGET integrated database retrieval system