KEGG   Trichoplax adhaerens: TRIADDRAFT_52741Help
Entry
TRIADDRAFT_52741  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K04962  ryanodine receptor 2
Organism
tad  Trichoplax adhaerens
Brite
KEGG Orthology (KO) [BR:tad00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tad04040]
    TRIADDRAFT_52741
Ion channels [BR:tad04040]
 Voltage-gated cation channels
  Ryanodine receptor
   TRIADDRAFT_52741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RYDR_ITPR RyR SPRY Ins145_P3_rec RIH_assoc RR_TM4-6 MIR EF-hand_7 EF-hand_8 Ion_trans EF-hand_5 EF-hand_1 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 6749570
NCBI-ProteinID: XP_002109077
JGI: 52741
UniProt: B3RK74
AA seq 4949 aa AA seqDB search
MESVLFYLLEIEDSITLSCNLANKYDSIQQCRAILAAVGFGSRLCHLEHWINTERLPNMS
LCVFILEQAMSVRALQERVVATTSVTGSGSQAGRRTLLYGHAVLLRHTSSRKYLSCLSSC
STSDKLAFDVGLEQHSQDESCWWTIHPASHHRSEGEKVRLGDNVIFVNVYSERYLYVSTS
SNDLTVQASFQQTVWIVNPVMSGWALTKSRGYLNGGDVMRFIRGGDEYLSIPDDYKCGSE
EQHWWSSAFIRWGQPFRLRNVISGQYIGMSDDKKHLCLLTSEAAKSEDSALFCLQPSQDN
ICIWDEKDEINQGMGIPEIKFGDSLVFLRHYKTGLWVGPQTTHGQRKQVIKEPFPFNIIA
NKKSSDIKVHLLVEGHMDSALSVTRGETEEIRTAHIIKVCSELLYQFLSSLGTGNSDDNN
ELTIKHETEDVDLKALEYIVFILNDLLGYFAWQKENLAHEVKQKHRVALKKRQELFQNEG
VISLVLDVIGKICRDGDSKITFQDVQNDSMWFKIHDLLFKLLAAMIRENHTNCTKLVEAI
SLDWLLKRLEREHYIDGLLQVLLCILTESSQSLSSVKEQHIKCMINLLDKHGRDNRILDM
LSRICVCNGVAVRANQNLICDNLLPKQKLLLQTKLVDQITSVTANIYVGLFNGSAQHSKW
YFEVAVDHVEPPSQDSVLCVANKAASPISHLRIGWRNIKEVHHAEAGENWSGAGIGDSIF
SYGFDGVNLWTNGRYLSVKNKPVSKAKRTMKKSGSMFCFIGQEKLGLNHSLNIAKDDLDD
SMESSSVADFDSEDNSYNDVDNELNQSIQEDKLNEEAAKTAPHQFRNGDVIGCYLDLGKQ
SMTFSINGKLITGEFRDISIDKQLFSPAISMSSTVRCRLLLGGDYGEFNYNSRHYAPIYE
GLDYGESVRVQESMVLGNPYRYEIIGPTAQTEHSVFIPAPIDTTDVSLPTYLNDLRDKLA
INMHDIWARNKIDAGWKFGRDRSDTLKVHPCLRPFTELSQEEKEYDIKMAMETLKSLVAL
GYVINVVGEGKNVTKYQHLPDSKYLLSNGYKPHPLDLAQKEILNDHLEKVVEILAKNAHE
VWAKDRIQQGWSYGLSKDGDRKRNPMLIPYEKLDEQSMKSNRDTARETIRTIIGFGCTID
SPAVDLNVDSAKSLSRQVTDRAQNGSMRTFRVEKMYAVRRGKWYYEFHVNSPGMMRVGWC
SEFFEAGKEVGGSSNSYSYDGFLARKWNHGSESFGKTWNKGDIVGCLLDLDTGKISFTLN
GELLQDGMSSYAFEDIDVTVGYLPACSLAVGQSGRINFGHDPTSFKYFNIFGYQENYDPF
GIVTSDSIPLWFASGIATFETINDTHPTVKVTEWLMHTRDHPTLRVNSKPLRNSSDQSHK
KFDLLRLNYPVNFTVPMVSSSRRKKSKFLGKYCFTLRIFKAQDPYEIYVGWISSKLHNYG
NSFGDYSSRKATMKGWKKQSDNSDDQLSSTNTATQVQKLHNALPSYWSDTTRECYMARVS
DLIAERGKRKISSAVLGDILIDCYANVNTGKLDFAFNGSTCQFTHFDVEEGAKLYPAIYV
RTPNNDKNLFQIEFRISKDCLPVCFTSNSHKLSQKSDATHLIKRPVLQALKANTWCRMQT
SSLVTVEKALRHGYEIEREDPSYSVMINIPEENRCINLQELIEKEKLMYFHTHTLKLYSA
LCSHGNIYVADKIRYYVDEWQLMYCIQCFDLPDVVRVGYYDLLVSLHLEEHAKARLLTRG
EYILPLKVEKATPISFTSSKSDNTTVSNGSYSLSAAPLPGTVLSPHRKSGLTHDVSCTIE
GAQAQSYSIQHTSLDKPLFPLTPLKKHVFRTLQYHMQAINRSRKETHRESRSLLLVPLLK
VADCLLVMGVLDESDMELLLLLLDPQNFGSKMTVSQATLEVGLLRMTDLDEPVKLELCQL
LDHLCDCQLRYRVESLVAYTSNFVDALQKEQRRRHNEIRNSQYPVAVTARKTREFRIPPR
TQLLMLLSFKTRETAESNPCSKDLQVSLRSYHKDVLKHCGKGNGIIKTTESVAVIDRLKK
SLWSSSKSTKNLQLTNANRATLQEILAEVLIAWGKQSITDVALIKAIFRLWFRLHDGMAE
LAEAITKTYTINDVGGDNVTNLLKALGSVRSLLTVRMGATEEMQMTNGLKELMNNTIFFQ
HPDLMRVLGVHKTVMEVMVNVLGKEVEKQKGSQFQSWAGATMDLSASTSPKPDGQSEITR
KCLSPVMVAACCKFLCFFCRTSQQNQRAMFEHMTYLLSHSDTSVTCTSMVGATPLDVAAA
AMKDNLELVLALRKHHLERVVSLLALTAPSTKIQSISDAVDMLTSGSTKARSSSLLNRSN
TWSNRMLRARRNRIISKLEMMFDAGWEPKEGERYLDFLRHAIWVDNESVEENASLVVRLL
IRRPECLGPALGSEGMGICQAFREAISLSLSTDDSATVNGKSRSEVGTQTLSFYSNLIDL
AAKCSSANPIDSYVPSDIRVKAIAGTDHRKVALKTRDRIKAILQSLIPLREIIGVLSLEF
SLPVPNKDKNCMELETRGLIPSHKIAMVTFLDRVYGVDSQEVLLRLLNYAFLPDLTNSIS
LDEVPLSTEMISAINRYISGSVMRLLTNHAHLFNGADSQPELMAKTIDVCYRLSKCSFLN
AAGQDSVNGFLLAFTCELKPSLMIKSLRILAHDMPVLIEENSVGLSILASHFERCGKYYN
SSGGWCTLGTASAEEKTLTMVLFTQLLGALSKGSYSKKLFSCALSCLFSSACSLSPDYVL
SQPGQTISPAASLHRSLSTDFEDIYIPQPVNTVNVILTDELKHLIHSYACNKHDIWAHKQ
FTEGWSFGFESDEYDKKDSLLLPYNLLSQKDKYHLNKYMNDCLRTILASGWSITSHGDIT
KEELIPYRKSAVNTNVSQSPHGYCPAPLDVSSIELSAETENIAAFLADNAHQLKQFEALE
ASGKGAVILIPYHILPDEDKERYLSQTRDFLRYMKLFKFECTRADRCTSIFGDTLTQYFT
TEKRFAFCLLQSIIGYTRPIEYELKQRKSPTDPVANTDFYAKVCIPLVQHYFEIHQSYFI
ATENQQQTVYGAATAREKKMVATLFYKLAMIARNDCNLFGSPAIVVDCIQVIVTVLDIGA
LIFHGFQDSVSNLQKLLLTAAEDLNNVVISYESKLMRYIFDVLLPILCSLFRQIFKYDVN
GIFSYDKVKTACFGIINSLYRLGCNDKIRDQKHLADIGNCLNLISASFTMPFLELNHTTV
NLSLFVRPISSDPFDIDVLAAESKHLSHHYNDINIGTNHGGNLAKSSNEQSHNDNIRLSL
SESEISNSYALPTIDESPEIQSHSNLPHLNELLNMVDDYVYSNCGFKKSSYITDVILPML
CSYISHWICINGRNRYTNSTTTTDEGSKVNENYANFLLGHILRIINTNFVTHDIPTIYRI
GDYALPLIKHCSASLLDTHFLPVTKKLTDFAIDLYRREDRLTKVADYDAQDEVDVMEDYI
KLAQNVRTFYPMLIKLTDRHKQTWITGCNKTGEELFRYVADMFSCWHLSQNFRREEQIYN
SSTMGKSNSDLITQLNESVFQTFQKVGRSRFTSYNLFQESSNGNQSNSSLVIVCVRKLLA
VGLNFINLAQRQLMHEAKSKLIQKETDSDVLFYVINKVRKMGDESRWAKRIVTSSAALIL
GLSFDDVQKELALKIMEYSRVLHRLHIVDNPQKTITKSWKKILSQQRKRAIMKCFTRVPL
YNLPKYRAVNVFIDVYRELWLSGEKCDGNALVETLTSIKVDEDNPLESDPLSQLVLTICR
DASNHEGDFNADSELYKIYADIMSESCIKFSEEDDDDDVEDGSASTFEESERAKRRLDQQ
QSRLAERNAAQMVLILLTESNGVVSPTILSILRLGISLLRGGNQNVQEIMLKYLQSTRNV
NFFTSLAKLTTSCSVLDLDTYERSAKAEILGLGFSDVAAGSAIHNIEFICSLFRFLQLLC
EGHNLKFQDYLRTQAGNTTTVNIIVCTVDYLLRLQESISDFYWHYSSKEIIDIQGRENFS
KAIRVAKQVFRTLTEYIQGPCVANQFTMSNSRLWDAVGGFWHVFACLQMKLSKETCHLEL
LRELLKLHSEMVIMLLSMLEGSNANSGSIAKQLMETIIDSSEYIEMILKFFNMFLKLNDL
GSSKSFKEFDIDGDGWISPSEFQKAMEQHKIYSSTEIDYLLKCADTNHDGKLDYMEFTER
FQRPAQEIGFNLAVLIANLTDHVPDDPRLAHLEDLISGIMTYFESSLGRIEILGPSQRIE
RVYFEIKTEHIDQWQKPQIQDSKRTFLRDVVTNGNADKEKLENFVGFCEDTIFEMQYGAR
ISGTAKAEQIQRALEKRERDFDVPSPKPFLSSIRKKLSWKTIKNSVSPLAFLKLMLFCVI
LPISFSARFLMLLWIWINHTLNFSNLAKKDTKASRVEFIFPHLQKFKSLFSFTDVRKRSK
AISFLLTHLANFTIKSFSNIMGSSSENVMIEFDWDNEEDGEGKHSYKPKIAAAKQTILSL
FARSYYASRIIALLIAFGINIILLFCKVTPVTEKNETLSSLGNSIILDSSNNYLDLALII
LPILHLLASIATLIAYWNLKVPLAIFKREKEIARKLEFDGYWVTKSRSQDYRDWWDGIVI
NCGSFPSMYWDKFIKRKVRDKYSEHDNDYHRITQILNIEDDENASEKGRIQKMAELLDLK
YWIWRIGVICTDRNFIYLLFYLLFSLLGNCLNNFFFAVHLIDFGFGNKTLSTVLQSVTHH
GRQLIMTLLMMAVVIYIYAVVAFNFFRQYYSREIRGRPEYKCDHMFTCFMFHLNSGLRSG
GGIGDTIDPADGDLYEYERIAFDFTFFFFVIVILLAIVQGLIIDAFGELRDKQESVKEDL
ENKCFICGIGKEHFDKVPHGFDIHVEKEHNLANYMFFLLHLIEKPETEYTGQESYVWGLY
QQRRWEFFPVGDCFRDQYQREQQLLVNNT
NT seq 14850 nt NT seq  +upstreamnt  +downstreamnt
atggaatcagttttattttacttgcttgagatagaagattctattactttatcatgcaat
cttgcaaataaatatgatagtatacaacaatgtcgcgccatattagctgcggttggtttt
ggaagtagactatgccatctagaacattggattaatacggaacgattaccaaatatgtcc
ctatgtgtatttatcttggaacaagctatgtcggttagagcattacaagaaagggtcgtg
gctactacctccgttactggtagtggtagccaagctggtaggagaacactattatatggt
catgcagtactgctacgccatacgagtagtagaaagtatctatcttgtttgtcatcatgt
tcgacttcagacaaattagcttttgatgttggtttggaacagcattctcaagatgaatca
tgctggtggaccatccacccggcgtcacatcatcgatccgaaggagaaaaagttcgactt
ggtgataacgttattttcgttaatgtatattccgaacgctatttgtatgtatcgacatca
tccaatgatttaaccgtacaagcatcatttcaacaaactgtatggattgtaaatcctgtc
atgagtggttgggcgttaacaaaaagccgaggctacttgaacggtggcgatgtcatgcgc
tttatacgcggcggtgatgaatatttatcgatacctgatgattataagtgcggctcggaa
gaacagcattggtggagcagcgcatttatccgatggggacaaccatttcgattgcgtaac
gttatatcaggccaatacatcggtatgtcagatgataagaagcatttatgtctactaaca
tctgaggcagcgaaatccgaagattcagcattattttgtctgcaaccttctcaggataat
atttgtatttgggacgaaaaagatgaaataaaccaagggatgggaataccagaaataaag
tttggagattctcttgtattccttagacattataaaaccggtttatgggtcggtcctcag
acaacccatggtcagcgaaagcaagttattaaagagccatttccttttaatattatcgct
aataaaaaatcatccgacattaaggtccacctcttagtcgaaggacatatggacagtgct
ctctctgtgactaggggggaaactgaagaaattcgcactgctcacataatcaaagtttgt
tctgagcttctatatcaatttttaagttccttaggtactggtaattccgatgataataat
gagttaacaatcaaacatgagacagaggatgttgatctcaaagctctagaatatatagtt
tttatactgaacgatcttcttggttactttgcatggcaaaaagaaaatttagctcatgaa
gtgaagcaaaaacacagggtcgcattaaaaaagcgccaagaattatttcaaaacgagggt
gttatttccctggttcttgatgttattggaaaaatttgtcgagatggcgattcaaagata
acttttcaagacgttcaaaatgactctatgtggttcaaaattcacgatctattatttaaa
ttattagctgcaatgatacgtgagaaccataccaattgtactaaattggtagaggccata
tcattagattggctactgaaaaggctagaaagagaacattacattgatggacttttacaa
gtacttttatgtattctaacggaaagttcgcaatcattaagtagtgtgaaagagcaacat
ataaaatgtatgatcaatctattggataaacacggtcgcgataataggattctagatatg
ctatcgaggatatgcgtatgtaatggcgttgctgttcgtgcaaatcaaaatcttatttgt
gacaatctactaccaaagcagaagttactacttcaaacaaaattagtagatcaaataact
agtgtaactgcaaatatttatgttggcttattcaatggttctgcccaacattctaagtgg
tattttgaagttgctgttgaccatgttgaacctccatcccaagattcggtattatgtgtt
gctaataaagctgcatctcctatcagtcacttacgaattggttggagaaatattaaggaa
gtacatcatgctgaagccggtgaaaattggagtggtgctggtataggggatagtatattt
tcatatggttttgatggcgtcaacttgtggacgaacggtcgatatctatcagttaaaaat
aagccggtttccaaggctaagcgtacaatgaagaaaagtggaagtatgttttgcttcatt
ggccaggaaaagttaggattgaatcattcactgaatattgctaaagatgaccttgacgat
tcaatggaaagctctagtgtggcagattttgacagtgaagataactcttacaatgatgta
gataacgaattgaaccaatctattcaagaagacaaattaaatgaagaagcagcgaaaaca
gcacctcaccagtttcgaaatggcgacgttatcggatgttatttagatttaggcaagcag
tcaatgactttcagcataaacgggaaattgataactggtgaatttagagatatttctata
gacaaacaacttttctcgccagctataagtatgtcctccactgttcgatgccgattactg
ttaggaggtgattacggggaatttaattataactcaaggcactatgctcccatttatgaa
ggcttagactatggagaatcggttagagtacaagaatctatggttcttggcaacccttac
cgctatgaaatcatcggtccgacagcacaaactgaacatagtgtatttattccagctcct
atcgatactacggacgtatccttacccacttatttaaacgatcttcgcgataaattagct
attaacatgcacgatatctgggctagaaataaaatagacgctggatggaagtttggaagg
gacagaagtgatacattgaaagtgcatccttgtttgagaccttttactgaattatcacaa
gaagaaaaagaatatgacattaaaatggctatggaaacgttaaaatcgttggttgcatta
ggctatgttataaacgttgttggagaaggtaaaaatgttactaaatatcaacatttacct
gatagcaaataccttttatctaatggatataagccccacccgttagacctagctcaaaag
gaaattttaaacgaccatttagaaaaggtagttgaaattttagctaaaaatgctcatgaa
gtatgggcaaaagatcgtatccaacagggttggtcatacggactttctaaagatggagat
agaaaaagaaatcctatgttaataccatacgaaaagcttgatgaacagtctatgaaatct
aatcgcgatactgcccgtgaaactattagaaccattattggatttggatgtaccattgat
tcgcctgcagtcgatctgaatgttgattcagctaaaagcttgtcacgtcaagttacagat
agagcccaaaacggcagcatgaggacctttcgtgttgaaaagatgtatgctgttcgtaga
ggcaaatggtactacgaatttcacgttaatagtcctggtatgatgagagttggatggtgc
tctgagttctttgaagccggaaaagaagttggtggtagtagtaactcatatagttatgac
ggattcttagctcgaaagtggaatcacggttcagaaagttttggaaagacttggaataaa
ggtgatatcgtcggatgcttgcttgatttagatactggtaaaattagctttacgttgaat
ggtgaacttttgcaagatggaatgtcctcatacgcttttgaagacatcgatgttaccgtt
ggatatctacctgcatgtagcttggctgttggtcaaagtggtagaattaattttggtcat
gatccaacttcatttaaatacttcaacatatttggctatcaagagaactatgatccattt
ggaattgttacatctgatagtattccgttatggtttgctagcggtattgctacattcgaa
acaatcaacgatactcaccctactgttaaagttactgaatggttaatgcatacccgagat
catccaacattgcgagttaatagtaaacccttgcgaaactcctcagatcaaagtcataag
aagttcgatttattgcgcctgaattatccagttaattttactgtaccaatggtctccagt
tcccgtaggaaaaaatccaaatttttaggaaaatattgctttacattgcgtatttttaaa
gcacaagatccgtacgaaatatatgtaggttggatatcatctaaactacataactacggc
aatagctttggagattattcttcgagaaaagcgactatgaagggttggaaaaaacaatcg
gacaactcggatgatcagctatcctcgactaatactgctacccaagtgcaaaaactgcac
aatgcccttccatcctactggagtgatacaactcgtgagtgctatatggcccgtgtttct
gatttgattgcagagagagggaaacgaaagataagttcagccgtgttaggtgatatttta
attgattgttacgccaatgttaatacgggtaaacttgatttcgcattcaatggatctacc
tgccaatttactcatttcgacgttgaggaaggagccaaactttatcctgcaatctatgtt
cgtactcctaataatgataaaaatctttttcaaattgaatttagaatttccaaagactgc
cttcctgtatgttttacttctaattcacataaattatcacaaaaaagcgatgctactcat
ctaattaagcgaccggtattacaagctctaaaagcaaatacttggtgtagaatgcaaaca
agctcgctagtaacagtcgagaaagctttgcgtcatggatatgaaattgaacgcgaagat
ccatcctacagtgtcatgattaatatacccgaggaaaatcgttgtataaatctacaagaa
ttaattgaaaaagaaaagttaatgtattttcacacccacacactaaaattatacagtgcc
ttgtgttctcatggtaatatttacgttgctgacaaaattcgttactacgtcgatgaatgg
cagttgatgtattgtattcaatgttttgatctgcctgatgttgtacgcgttggttactat
gatttattagtatcattacacttagaagaacatgctaaagctagattattaactagagga
gaatacatcttacctcttaaagtggaaaaagcaacaccaatatcttttacgtccagtaaa
agtgataatacaacagtaagtaacggctcttattccttatccgcagctcccctacccggc
acggttttaagcccacataggaaatctggtcttacgcacgatgtttcgtgcacaattgaa
ggcgcacaagcgcagtcttattctattcagcatacttcgttagataaacctctttttcct
ttaacaccacttaaaaagcatgtctttagaactttacaatatcatatgcaagccattaat
cgtagtcgtaaagaaactcatcgtgaaagtcgtagtctattattggtaccgttactcaaa
gtcgctgattgtttgttagttatgggagtactagatgaaagcgacatggagctattgttg
ttactcctagatccgcaaaatttcggatcgaagatgactgtctctcaggcaacccttgaa
gtagggttattaagaatgactgacttggatgaacccgttaaattggaattatgtcagtta
ttggatcatttatgtgattgccagctacgttatagagttgaatctttggttgcatacact
tctaatttcgtcgatgctctgcaaaaggagcaaagacgtaggcacaacgaaattagaaat
agtcaatatcctgttgcggtaactgctagaaaaacaagagaatttcgtattccaccacga
actcaacttttgatgttattgtcatttaagacgcgtgaaacagcggaaagtaatccttgt
agtaaagatttacaagtctcgttaagaagctatcataaagacgttctgaaacattgtggt
aaaggaaatggaatcattaagactacagaaagtgtcgctgtaatagatagattaaagaaa
tcgttatggtctagtagcaaatcgactaaaaatttacaactgactaatgcaaatagagcg
acattgcaagaaattctagctgaagtcttaatagcttggggtaaacaaagtattacagat
gttgctttgattaaagctatattccgtttatggttcagattacatgatggtatggcagaa
cttgctgaagctattacaaagacctacactatcaatgatgttggaggtgataatgtaaca
aatcttctgaaagcattaggttcagttaggtcgctcttaacggtcaggatgggcgcgact
gaagagatgcaaatgactaatggattgaaagaactaatgaacaatacgattttctttcag
catcctgatttaatgcgtgttttaggggtacataaaacagttatggaggttatggtcaac
gttttaggtaaggaagtcgaaaaacaaaaaggttcgcaatttcaatcttgggcaggtgct
actatggacctttcagcatcaacttctccaaaaccagatggacaaagtgagataactaga
aaatgcctctctccggttatggtagctgcatgttgtaaatttttatgctttttttgtcgt
accagtcaacaaaatcagcgtgctatgttcgaacatatgacttatttattatctcacagt
gataccagtgttacatgcacaagcatggtaggtgcaacacctttggatgttgccgctgca
gctatgaaagataatttagagcttgtattggcacttcgtaaacatcatttagagcgtgta
gtatcgcttttagcacttactgctccgagtacaaaaatacagtcaatatcagatgcagtt
gatatgctcacctctggatctacgaaagcgaggtcgtcgtcgttactgaatcgttccaat
acttggagtaatcggatgctaagagctagacgaaatagaattattagtaagctagaaatg
atgtttgacgcaggttgggagcctaaggaaggcgaaaggtaccttgattttcttcgtcat
gccatttgggtggacaatgagtctgtagaagaaaatgcatcattagttgtgcgcttacta
atacgacgacctgaatgcttgggtcctgctctgggtagtgaaggaatgggtatctgtcaa
gcattcagagaagctatttcgttgtctcttagcactgacgattccgctacagtcaatggt
aaatcacgttcagaagttggaactcaaactttatcgttttactctaatctgatagattta
gctgccaaatgttcatccgctaatcctatcgactcgtatgtgccttctgatatacgtgtt
aaagccattgctggtacggaccatagaaaggtggctcttaaaactcgagatcgaattaaa
gctatacttcaaagtcttattcctttacgtgaaatcattggcgttctcagtttggaattt
tcattgcctgtgccaaataaagataaaaattgtatggaattggaaacaagaggcttgata
ccatcacataaaatcgcgatggtaacatttctagatcgtgtttatggtgttgacagtcaa
gaggttctattacgtttgcttaattatgcatttttacctgatttaactaattcaataagt
ttggatgaagttcctttatcgacagaaatgatatcagctattaatcgatacataagtggt
agtgttatgcgtttactaactaatcacgcccatttattcaatggtgctgatagccagcca
gaattaatggctaagactattgacgtgtgttatcgtttatcaaaatgttcattcttaaat
gccgctggtcaagatagtgtcaatggatttctacttgcttttacatgtgaattaaagcct
agtctaatgattaaatcattgagaatattagcgcacgatatgccggttttaatcgaggaa
aattctgtaggtttatctatacttgctagccattttgagcgttgcggtaaatactataat
tcatccggtggttggtgtaccctgggtaccgcttcagcagaagaaaaaacgttaactatg
gtattgtttacacaactcttaggagcattgtcaaaaggcagttattcgaaaaaattattt
tcttgtgctttatcatgcttgtttagtagtgcatgttcactatcaccggattacgtcctt
tctcaaccaggacaaaccatttctccggccgcatctttacatcgtagccttagtaccgac
tttgaggatatttatataccgcaacctgttaatacggttaatgtaattttaacagatgaa
ttaaaacacttaatccattcgtacgcatgcaataagcacgacatttgggcacataaacaa
tttacggaaggttggtcctttggtttcgaatccgatgaatatgataaaaaagatagttta
ctccttccatataacttgttaagtcaaaaggacaaatatcatttaaataaatatatgaat
gattgcctcagaacaattttggcctcaggctggagtataacaagtcatggagatatcacg
aaagaagaattaatcccttacagaaagagtgccgtcaatacaaatgtatcgcaatcgcca
catggttattgtccagcgccacttgacgtctctagtatcgaattaagtgctgaaactgaa
aatatagctgcatttttagctgataatgcccatcaattgaaacaatttgaggccttagaa
gcatctggcaaaggagcagttatactgataccttatcatatattacctgatgaagataaa
gagcgatacctaagccaaactcgagactttcttcgctacatgaaattattcaaatttgaa
tgtactcgtgcagatcggtgtacatctatatttggtgatacattaactcaatactttaca
acggaaaagagatttgcattttgcctactacaaagtatcatcggttatactagacctata
gaatatgaactaaagcagcgtaaaagcccaaccgatccagtagctaacaccgacttttat
gctaaagtatgcataccacttgtacagcattactttgaaatacatcagtcgtattttatt
gccacagaaaatcaacagcagactgtctacggtgcagcaactgctagagagaaaaaaatg
gtagcaacattgttttataaattagccatgattgctagaaatgattgcaatttattcggt
tctccagcaatcgtagttgattgtattcaagttatagtaaccgttctagacattggagca
ttaatatttcatgggtttcaagattcagtatctaatctgcagaaattactattgacagct
gcagaagatttaaataatgtggtaatatcttatgaatcaaagcttatgcgatatattttt
gacgtacttctacctattttgtgttcattatttcgacaaatatttaaatacgatgtgaat
ggaattttttcttacgacaaggtgaaaactgcatgtttcggcataattaatagtttatat
cgacttggttgtaatgacaagatacgagatcagaaacatttagctgatattggaaattgc
ctgaatttaatatcggcttcatttactatgccattcttagaattgaatcataccactgtt
aatttatccttatttgttagaccgatttcatcagaccctttcgatatagacgttttagct
gctgaaagcaaacatttatcacaccactataatgatattaacattggtacaaatcatggt
ggtaacttagcaaagtcaagcaacgagcaatcccataatgacaatataagactgtcgttg
tcagagagcgaaattagtaatagctacgcattaccaacaatagacgagagcccagaaatt
caatctcattctaatttaccgcatttaaatgaattactaaatatggttgatgattacgtt
tattcgaattgtggattcaaaaaatcgtcttatattactgatgttatattgccaatgtta
tgtagttatatatcgcattggatttgtataaatggacgtaacagatatacgaattcgaca
accactaccgatgaaggtagcaaagtcaacgagaattatgctaatttcctgctaggtcac
atcctgcgtattattaatacgaattttgtaacacacgatattccaacgatatatcgtata
ggtgattacgctttacctttaatcaaacactgttcagcgtcattactagatacccatttc
ttgccagtaactaaaaaattaactgattttgcaatcgatctatatcgacgcgaagataga
ttaaccaaagtggctgattatgatgctcaagatgaggttgatgttatggaagattatatc
aagttagctcaaaatgtaagaacattttatccaatgttaattaaattaacagataggcat
aagcaaacatggataactggatgcaataagactggtgaagaattgtttcgatatgttgct
gatatgttcagttgttggcatctgtctcaaaattttcgtcgtgaagagcaaatatacaat
tcaagtactatgggtaaaagtaatagtgatttaataactcaactgaatgaaagcgtattt
caaacatttcaaaaagtcggccgaagcagatttacatcttataatttatttcaagagagc
agtaacggcaatcaaagcaacagtagcttagttatcgtttgtgtaagaaaactgttagct
gttggtcttaactttattaatttagcacaaagacaattaatgcatgaagctaagtcaaaa
ttaatacagaaagaaacagacagcgatgtgttgttttatgtaataaataaggtgcgtaag
atgggagatgaatcaagatgggctaagcggattgtaacatcatcggctgcgttaatattg
ggattatcatttgatgacgttcaaaaagagcttgctttaaaaataatggaatattctcgt
gtactgcatcggttacatattgtggataatccacaaaaaacaatcaccaagtcatggaaa
aaaatcttatcgcaacaacgcaaacgagcaattatgaaatgctttactagagtgccattg
tataatctgcctaaatatcgagctgttaatgtttttattgatgtttatcgtgagctatgg
ctaagtggtgaaaagtgtgatggcaacgctttagttgagactttaacaagtataaaagta
gatgaggacaaccctttagagtccgatccattgtcgcaattggtattaacgatttgtcgt
gatgctagcaatcacgaaggtgactttaacgctgatagcgaattgtataaaatttacgcc
gatatcatgagtgagagttgtatcaaattcagtgaagaggatgacgatgatgatgttgaa
gatggatcagcgtcaacatttgaagaaagtgaaagagctaaacgacgattagatcagcag
caaagtagacttgccgagcgcaatgcagcacaaatggtattaatactattaactgaaagt
aatggtgttgtaagccctactatacttagtatcttacggttagggatatctttacttcga
ggtggtaatcaaaatgtacaagaaatcatgttaaaatatttgcaatcgacacgaaatgtc
aatttctttacaagtttagctaaattgactacatcttgtagtgttctcgatttggataca
tatgagcgtagcgctaaagctgaaatactaggcttaggatttagtgatgtagctgcgggt
agtgctatccataatatcgaatttatttgttcattatttcgatttctacaattattgtgc
gagggtcataatctgaaatttcaagattatttgcgaacgcaggctggaaatacaactaca
gtgaatatcatagtttgcaccgttgattatttattgcgcttacaagaatctattagtgac
ttctattggcattactcgagtaaagaaattattgatatacaaggaagagaaaattttagt
aaagctattcgtgtagccaaacaggtatttcggacattaactgaatatatacaaggtcca
tgtgtggctaatcaattcactatgtcaaatagtcgattatgggatgctgtaggcggtttt
tggcatgtgtttgcatgtttgcaaatgaagctatctaaagagacttgccatctagaatta
ttgcgcgaattgctaaaattgcattctgagatggtgatcatgttattgagtatgttagaa
ggtagtaatgctaattcgggctcaattgctaaacaattaatggaaacgatcatagattca
tctgaatacatcgaaatgatattaaaatttttcaacatgtttttaaaattaaatgatttg
ggtagttctaaatccttcaaagaatttgatatagatggagatggatggatatccccaagt
gaatttcaaaaagctatggaacaacataaaatttattcatcaactgagattgattattta
ctaaaatgcgcagataccaatcatgatggcaaattagattatatggaatttactgaaaga
tttcaaaggcctgctcaagaaattggtttcaatctagccgttttaattgcaaatctaact
gaccatgttcctgatgatccaaggttagcccacctggaagacctgatctcaggaattatg
acttattttgaatcaagtctggggaggattgaaatcttaggtccgagtcaaagaattgaa
agagtgtatttcgaaattaaaacggaacatattgatcaatggcagaaaccacaaatacaa
gattcgaaacggacattcttacgtgacgtagtgactaatggcaatgcggataaagagaaa
cttgaaaacttcgttggcttttgcgaagatactatttttgagatgcaatacggtgctaga
attagtggaaccgctaaagctgaacagattcaacgtgcattggaaaagcgagaaagggat
tttgatgttccatcaccaaaaccttttctatcgtcaatacggaaaaaactaagttggaaa
accataaaaaattccgtttctcctctagcctttttaaaattaatgcttttttgcgtgatc
ttacctataagcttttcagctcgatttcttatgcttttatggatttggatcaatcacaca
ttaaattttagtaatttagctaagaaagatactaaagctagccgtgtggaatttatattc
cctcatctacaaaaatttaaaagcctttttagctttactgatgttcgaaaaagaagcaaa
gcgatcagttttcttttaactcatttagccaattttactatcaaatcgttcagtaatata
atgggtagtagtagtgaaaatgtaatgattgaatttgattgggataacgaggaagatggt
gaaggcaaacattcttataaaccgaaaatagcagcagcgaaacaaacgattttgtcttta
tttgcaagaagctactacgcatcgagaataattgctctattaatagcttttggaattaat
attatcttgctattttgtaaagtcacacctgttactgaaaagaatgaaactttgtcatct
ttgggcaacagtattattttggatagtagcaataactacctagatttggcattaatcata
ctaccaattttgcatcttcttgcatccattgcaacactaattgcttattggaatttaaag
gttccattggccatatttaaaagagaaaaagaaattgctcgaaagttagaatttgatggt
tactgggtaacaaagtctcgtagtcaggattatcgcgattggtgggatggtatagtcatt
aattgcggatcatttccgtcaatgtattgggataagtttataaaacgcaaagtacgagat
aaatatagtgaacacgataatgattaccatcgtataacacaaatattgaatattgaagac
gacgagaacgcttctgaaaaggggcggatacagaagatggctgaattattggatttaaaa
tactggatatggaggattggagtaatatgtactgacaggaattttatctatctactcttt
tacttgctgttttccttacttggaaattgtttgaataatttcttcttcgccgtgcacttg
atcgactttggcttcggtaataaaactctgagtaccgtattgcaatctgttactcatcac
ggccggcagctaataatgacgctgttaatgatggctgtggtgatttatatttacgctgtg
gtagcatttaacttcttccgccagtactacagtagagaaattagaggcagaccagagtac
aaatgtgatcacatgtttacgtgttttatgtttcatctcaattctggtctacgatctggc
ggtggaattggtgatacgatcgatcctgctgatggtgacttatacgaatatgaaagaatc
gcttttgattttaccttcttcttctttgtaatcgttattctattagctattgtgcaaggt
ttaattattgatgcttttggcgaacttcgtgataaacaagaatctgtcaaagaagaccta
gagaataaatgtttcatttgtggaatcggaaaagaacactttgacaaagtaccacatggg
tttgatattcatgtagagaaagagcacaatctcgctaactatatgttttttttgttacac
ttgattgaaaaacccgaaacggaatatactgggcaggaatcttatgtatggggtttatat
caacagagaagatgggaatttttccccgttggtgactgttttagagatcagtaccaacga
gaacagcaacttcttgtaaataatacgtaa

DBGET integrated database retrieval system