KEGG   Trichoplax adhaerens (placozoan): TRIADDRAFT_52968
Entry
TRIADDRAFT_52968  CDS       T01069                                 
Name
(RefSeq) hypothetical protein
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
tad  Trichoplax adhaerens (placozoan)
Pathway
tad00051  Fructose and mannose metabolism
tad00520  Amino sugar and nucleotide sugar metabolism
tad01100  Metabolic pathways
tad01240  Biosynthesis of cofactors
tad01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:tad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TRIADDRAFT_52968
   00520 Amino sugar and nucleotide sugar metabolism
    TRIADDRAFT_52968
Enzymes [BR:tad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     TRIADDRAFT_52968
SSDB
Motif
Pfam: PMM Hydrolase_3 S6PP HAD_2
Other DBs
NCBI-GeneID: 6750978
NCBI-ProteinID: XP_002109189
JGI: 52968
UniProt: B3RMY2
AA seq 248 aa
MTAKILVLFDVDGTLTPARKLIEDNMKCTLENLKKHVAVGIVGGSDYGKIKEQLGGEDIP
KFYDYVFAENGVVGYKKGELISAENIVSCIGDDNLQKVINFALKYMSELQLPRKRGTFVE
FRSSMINLCPIGRSCSYDERLEFVALDKAENIRLKFLQALRKEFPDVGLQFAIGGQISID
VFPIGWDKTYCLRHIPANEFDQIYFFGDKTQPGGNDHEIFNSERTIGHTVTSPEDTVCQL
KKLFPQIA
NT seq 747 nt   +upstreamnt  +downstreamnt
atgactgccaaaatacttgtattattcgacgtggatggcacattaacgccagctcgcaag
cttattgaggataacatgaaatgcaccctagaaaaccttaagaaacatgttgctgttggc
attgttggtggatcagattatggcaaaatcaaggaacaattgggtggagaggatattccc
aagttttatgattatgtctttgctgaaaatggagttgttggttataagaagggtgaatta
ataagcgctgagaatattgtcagctgcatcggagatgataacttacagaaagtcattaac
tttgctttaaaatacatgtctgaattgcaattgcctaggaaaagaggtacttttgttgaa
ttccgctctagcatgattaatctttgtcctattggacgcagctgtagctacgacgaaaga
ttggaatttgtcgctttggacaaggctgaaaatattcgactcaagtttctacaagctctc
cgaaaagaatttcctgatgttggcctacaatttgcgatcggtgggcaaattagtattgat
gtctttccaatcggatgggacaaaacttattgcctacgtcatataccagcgaatgaattc
gatcaaatttatttctttggtgacaaaactcaaccgggtgggaacgatcacgaaattttt
aatagcgaacgcacaattggtcataccgttacatcgccagaagatacagtttgccaattg
aaaaaacttttccctcagatcgcgtaa

DBGET integrated database retrieval system