KEGG   Trichoplax adhaerens: TRIADDRAFT_54517
Entry
TRIADDRAFT_54517  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K17292  tubulin-specific chaperone A
Organism
tad  Trichoplax adhaerens
Brite
KEGG Orthology (KO) [BR:tad00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tad04812]
    TRIADDRAFT_54517
   04147 Exosome [BR:tad04147]
    TRIADDRAFT_54517
Cytoskeleton proteins [BR:tad04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     TRIADDRAFT_54517
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TRIADDRAFT_54517
SSDB
Motif
Pfam: TBCA Phage_GP20
Other DBs
NCBI-GeneID: 6751688
NCBI-ProteinID: XP_002111011
JGI: 54517
UniProt: B3RS94
AA seq 109 aa
MADNAASLRQLKIKTGVVRRLVKEKAMYEKEVIDQQARIDKLKANNEDEYVIKKQIEVLQ
ESENIIPDCQKRIKAAIADLQRLLENESNLASCEEYEVAKKLLSEVTAQ
NT seq 330 nt   +upstreamnt  +downstreamnt
atggctgataatgctgcaagtttgagacagttaaagattaaaactggcgtagtaagaagg
ttagtaaaagaaaaagcaatgtatgagaaagaagtgattgatcagcaagcaaggattgat
aagttgaaagccaataatgaagatgaatatgtgatcaaaaaacagattgaggtattgcaa
gaatccgaaaatataattcctgattgccagaagcgaatcaaagctgctattgctgactta
caaagactgctggaaaacgaatcaaacctagccagttgtgaagaatacgaagttgctaaa
aaattactatcggaagtgactgctcaatag

DBGET integrated database retrieval system