KEGG   Trichoplax adhaerens: TRIADDRAFT_55020Help
Entry
TRIADDRAFT_55020  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
tad  Trichoplax adhaerens
Pathway
tad04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    TRIADDRAFT_55020
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     TRIADDRAFT_55020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 6752470
NCBI-ProteinID: XP_002111257
JGI: 55020
UniProt: B3RQK3
AA seq 347 aa AA seqDB search
MDAGESPSSGTIVNEFFHRVGGHNTIYLFDETTICKALLPREFYFYKRLKNSLRSFIPDY
KGIVKIDMKDEERIRAYRVTEADLSATDLDFTKEYFSPEIVNDIYKKEESCDTSKSDKEI
NQQTTSKGPECSSQGLADTDKLEYSAYILLENVSSKFINPCILDLKMGTRQHGDTASSVK
AQKQMERTKSTTSSKLGVRMCGMQIYSEAERAFRRRDKYYCRSLSVEGFKHHLYEFLCNG
TDKLRVDVCIDFLQRLKEMKQVIEEHRGYRFFSSSLLFIYEGQLDSPGKNRTNKADIDIR
IIDLAHTTCDRLLHKLPPYEGPDEGFLKGLQNIYDFLYEFVERERKI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaggagaaagtccaagctcaggcacgatcgtgaacgaatttttccatcgagtt
ggtggccataacacgatatatttgttcgatgaaacgacgatatgtaaagcgttattgccg
cgagagttttatttctataaaagattaaaaaattccttgcgatcttttataccagattat
aaaggtatcgtaaaaattgatatgaaagatgaagaaagaatacgtgcttatcgagtaaca
gaagctgatttatctgctacagacttggactttacaaaagaatatttctcgcctgagatc
gtcaatgatatctataagaaagaagaatcttgcgatacatcaaaaagtgacaaagaaatc
aatcaacagaccactagtaaaggaccagagtgtagctcacaaggtctcgcagatactgac
aagttagaatattcagcatacattcttttagagaatgtatcctccaaatttatcaatcct
tgcatcttagatcttaaaatgggcacaagacagcatggagatactgcttccagcgtaaaa
gctcagaagcaaatggaaaggactaaaagtacaacctccagcaaattaggtgttcgtatg
tgtggcatgcagatctatagcgaagcagaaagagcgttccgtcgtcgtgataaatattac
tgccgatcattatctgttgagggctttaaacatcatttatatgaatttctttgcaatggt
actgacaaattgcgagtcgacgtttgcattgactttctgcaaagactaaaagaaatgaaa
caagttatagaggaacaccgtggttaccgatttttctccagttctttacttttcatctac
gagggccagctggatagcccaggtaagaatcgcaccaacaaggctgacattgatattcgt
ataatcgatttggctcacacaacttgtgataggttgctccataaattgcctccttatgaa
ggtcctgatgaaggatttctcaagggactacaaaatatatacgattttttatatgaattt
gttgaacgagaacgaaaaatttag

DBGET integrated database retrieval system