KEGG   Trichoplax adhaerens: TRIADDRAFT_56125Help
Entry
TRIADDRAFT_56125  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRIADDRAFT_56125
Peptidases [BR:tad01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   TRIADDRAFT_56125
Ubiquitin system [BR:tad04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    TRIADDRAFT_56125
  UBL-specific proteases (ULPs)
   TRIADDRAFT_56125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12 Herpes_IE2_3
Motif
Other DBs
NCBI-GeneID: 6753479
NCBI-ProteinID: XP_002112719
JGI: 56125
UniProt: B3RX91
AA seq 227 aa AA seqDB search
MSGQTSRWLPLESNPEFAYALGVPKAWQFVDVFGLDDELLAFLPQPVVALLVLFPITSKY
ENYITDEVNRLGTQGQFVGDDVYFMKQTIGNACGTIALIHAFGNNSANVQLDNGYLKEFL
QATANMNAVERAAYLENDNEITSAHEACAHEGQTQAPSVNEEVNLHYVALVQNGGHLYEL
DGRKPFPINHGSSSPESFLKDAAKVCQSLMQRDPTEVNFSIIALAQA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtcaaacatcacgttggttgccgcttgaatccaacccagagtttgcttatgct
ttaggggtccccaaagcatggcagtttgtcgatgttttcggattagacgatgaattacta
gctttcttacctcaacctgtcgtagccttattagttctatttcctataacatcgaagtac
gaaaattacataactgatgaagtcaatcgacttggtactcaaggccagtttgttggcgac
gatgtctattttatgaagcaaacgattggcaacgcttgtggtacaatcgcacttatacat
gcattcggcaacaacagtgcaaatgttcagctcgataatggctacctaaaggaattttta
caagctacagctaacatgaatgcggtagaaagagcagcctatcttgaaaatgataatgaa
attacttctgctcacgaagcatgcgctcatgaagggcaaactcaggctccaagcgttaac
gaggaggttaacttgcattacgttgctctcgtccaaaatggtggccatttatatgagtta
gatggacgcaaaccgttccctatcaatcatggctcctcaagccccgaatcatttctaaag
gatgccgctaaagtgtgtcaatctcttatgcagcgtgatccaacagaagtaaattttagt
attatcgcgttggcacaagcataa

DBGET integrated database retrieval system